Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8540
Gene name
Locationscaffold_97:13755..18531
Strand-
Gene length (bp)4776
Transcript length (bp)4548
Coding sequence length (bp)4545
Protein length (aa) 1515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 1.3E-45 502 712
PF01061 ABC2_membrane ABC-2 type transporter 3.5E-47 1190 1405
PF00005 ABC_tran ABC transporter 3.8E-14 182 336
PF00005 ABC_tran ABC transporter 1.0E-16 887 1038
PF06422 PDR_CDR CDR ABC transporter 3.2E-33 738 823
PF14510 ABC_trans_N ABC-transporter N-terminal 1.3E-14 75 153
PF19055 ABC2_membrane_7 ABC-2 type transporter 8.7E-08 1067 1129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 96 1507 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 23 1506 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 74 1514 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 74 1514 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 82 1508 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 96 1507 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 23 1506 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 74 1514 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 74 1514 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 82 1508 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 75 1514 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 82 1514 0.0E+00
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 82 1505 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 86 1512 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 105 1506 0.0E+00
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 45 1504 0.0E+00
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 129 1504 0.0E+00
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 155 1484 0.0E+00
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 86 1507 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 100 1507 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 91 1507 0.0E+00
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 105 1503 0.0E+00
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 102 1503 0.0E+00
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 33 1507 0.0E+00
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 127 1507 0.0E+00
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 88 1507 0.0E+00
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 127 1510 0.0E+00
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 186 1506 0.0E+00
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 184 1506 0.0E+00
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 169 1487 2.0E-162
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 164 1412 2.0E-143
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 149 1436 2.0E-142
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 113 1412 4.0E-142
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 164 1422 3.0E-141
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 172 1412 3.0E-137
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 170 1412 1.0E-136
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 146 1412 3.0E-134
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 157 1415 4.0E-134
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 147 1412 4.0E-134
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 113 1412 9.0E-134
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 153 1398 1.0E-133
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 153 1424 1.0E-133
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 166 1127 5.0E-133
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 149 1412 2.0E-132
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 157 1412 3.0E-132
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 110 1412 3.0E-132
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 170 1405 2.0E-130
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 170 1416 2.0E-130
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 164 1437 7.0E-130
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 158 1416 1.0E-129
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 170 1420 2.0E-129
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 117 1412 7.0E-129
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 158 1406 3.0E-128
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 164 1422 7.0E-128
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 145 1412 9.0E-128
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 153 1420 1.0E-127
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 151 1415 2.0E-127
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 131 1411 4.0E-127
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 123 1411 5.0E-126
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 168 1438 5.0E-125
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 151 1417 7.0E-125
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 153 1412 2.0E-124
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 170 1436 2.0E-124
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 151 1417 2.0E-124
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 166 1411 3.0E-123
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 170 1126 4.0E-122
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 164 1411 2.0E-121
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 133 1419 2.0E-120
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 164 1412 5.0E-120
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 131 1410 2.0E-119
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 165 1314 3.0E-118
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 126 1404 5.0E-118
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 170 1438 1.0E-117
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 172 1391 4.0E-114
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 117 1412 2.0E-109
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 835 1503 4.0E-73
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 866 1503 2.0E-71
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 870 1313 1.0E-62
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 170 803 1.0E-60
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 170 797 3.0E-59
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 864 1383 6.0E-59
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 874 1431 7.0E-59
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 847 1383 3.0E-58
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 874 1425 7.0E-58
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 874 1415 7.0E-57
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 866 1383 5.0E-56
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 867 1383 7.0E-56
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 867 1383 8.0E-55
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 174 717 5.0E-53
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 864 1383 6.0E-53
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 874 1317 2.0E-50
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 849 1496 3.0E-50
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 880 1503 7.0E-50
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 849 1490 4.0E-49
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 134 717 4.0E-49
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 174 717 4.0E-49
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 174 729 7.0E-49
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 174 717 7.0E-49
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 870 1294 9.0E-49
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 867 1443 1.0E-48
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 161 717 4.0E-48
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 883 1398 9.0E-48
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 866 1404 1.0E-47
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 868 1130 2.0E-47
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 867 1398 5.0E-46
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 886 1404 7.0E-46
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 133 718 9.0E-46
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 870 1315 1.0E-45
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 870 1314 2.0E-45
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 844 1403 3.0E-45
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 870 1178 4.0E-45
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 868 1320 8.0E-45
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 863 1133 1.0E-44
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 867 1398 1.0E-44
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 884 1431 3.0E-44
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 870 1303 4.0E-44
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 886 1417 5.0E-44
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 880 1398 9.0E-44
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 845 1152 2.0E-43
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 886 1398 5.0E-43
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 867 1398 6.0E-43
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 846 1398 1.0E-42
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 846 1398 1.0E-42
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 878 1418 1.0E-42
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 821 1422 2.0E-42
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 877 1404 2.0E-42
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 155 807 3.0E-42
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 864 1388 3.0E-42
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 868 1132 6.0E-42
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 868 1319 8.0E-42
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 854 1202 9.0E-42
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 175 708 1.0E-41
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 834 1422 2.0E-41
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 175 717 3.0E-41
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 867 1398 3.0E-41
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 170 712 6.0E-41
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 880 1421 7.0E-41
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 174 696 1.0E-40
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 174 696 3.0E-40
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 886 1404 3.0E-40
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 882 1398 6.0E-40
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 172 712 8.0E-40
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 870 1130 8.0E-40
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 879 1128 1.0E-39
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 880 1317 3.0E-39
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 804 1128 4.0E-39
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 163 716 5.0E-39
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 135 712 1.0E-38
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 170 721 3.0E-38
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 175 808 4.0E-38
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 100 717 4.0E-38
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 882 1130 6.0E-38
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 111 712 1.0E-37
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 170 808 2.0E-37
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 819 1313 4.0E-37
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 863 1127 5.0E-37
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 146 719 6.0E-37
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 175 808 1.0E-36
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 868 1320 2.0E-36
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 175 708 4.0E-36
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 884 1142 4.0E-36
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 130 721 5.0E-36
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 158 720 5.0E-36
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 881 1404 7.0E-36
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 886 1404 8.0E-36
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 175 808 1.0E-35
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 171 721 2.0E-35
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 877 1196 7.0E-35
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 176 717 8.0E-35
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 877 1185 9.0E-35
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 171 721 1.0E-34
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 155 717 1.0E-34
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 119 717 2.0E-34
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 165 810 2.0E-34
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 183 718 3.0E-34
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 841 1314 7.0E-34
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 175 717 1.0E-33
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 175 717 2.0E-33
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 162 712 4.0E-33
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 876 1508 6.0E-33
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 187 799 6.0E-33
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 175 808 1.0E-32
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 175 747 1.0E-32
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 884 1353 1.0E-32
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 175 633 2.0E-32
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 884 1353 4.0E-32
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 894 1341 5.0E-32
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 167 712 1.0E-31
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 884 1128 1.0E-31
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 175 810 1.0E-31
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 175 810 1.0E-31
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 155 731 2.0E-31
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 167 808 2.0E-31
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 186 797 3.0E-31
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 894 1229 4.0E-31
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 884 1352 7.0E-31
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 175 810 9.0E-31
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 173 721 1.0E-30
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 175 810 1.0E-30
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 164 712 2.0E-30
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 170 712 2.0E-30
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 175 738 2.0E-30
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 894 1127 2.0E-30
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 175 710 3.0E-30
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 175 423 4.0E-30
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 175 710 1.0E-29
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 175 810 1.0E-29
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 168 719 1.0E-29
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 126 714 2.0E-29
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 164 712 2.0E-29
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 134 729 2.0E-29
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 168 719 2.0E-29
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 175 716 3.0E-28
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 142 818 3.0E-28
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 175 810 6.0E-28
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 174 719 1.0E-27
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 175 424 2.0E-27
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 164 712 2.0E-26
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 886 1404 2.0E-26
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 164 712 3.0E-26
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 164 712 7.0E-26
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 167 712 7.0E-26
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 167 712 8.0E-26
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 897 1423 1.0E-25
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 126 712 3.0E-25
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 167 808 3.0E-25
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 126 714 6.0E-25
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 186 712 1.0E-24
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 167 712 5.0E-24
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 167 712 8.0E-24
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 167 712 2.0E-23
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 174 712 2.0E-23
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 836 1093 1.0E-22
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 175 422 2.0E-22
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 886 1128 3.0E-22
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 142 809 4.0E-22
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 169 813 1.0E-21
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 175 432 2.0E-21
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 101 712 2.0E-20
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 145 712 3.0E-19
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 156 417 4.0E-18
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 175 813 2.0E-17
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 167 402 3.0E-17
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 173 723 4.0E-17
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 885 1067 9.0E-17
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 862 1055 2.0E-16
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 862 1055 2.0E-15
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 844 1067 4.0E-14
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 175 431 6.0E-14
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 885 1086 7.0E-14
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 886 1086 9.0E-14
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 887 1097 1.0E-13
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 175 792 2.0E-13
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 520 736 2.0E-13
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 867 1097 3.0E-13
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 894 1117 3.0E-13
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 887 1086 5.0E-13
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 887 1086 5.0E-13
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 887 1086 5.0E-13
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 886 1067 6.0E-13
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 882 1087 6.0E-13
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 872 1086 9.0E-13
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 887 1095 1.0E-12
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 886 1086 1.0E-12
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 886 1086 1.0E-12
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 155 424 2.0E-12
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 884 1101 2.0E-12
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 884 1086 2.0E-12
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 894 1067 2.0E-12
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 894 1067 2.0E-12
sp|Q4AA74|ECFA2_MYCHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=ecfA2 PE=3 SV=1 875 1103 4.0E-12
sp|Q601T6|ECFA2_MYCH2 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain 232) GN=ecfA2 PE=3 SV=1 875 1103 4.0E-12
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 853 1097 4.0E-12
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 884 1097 4.0E-12
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 879 1097 4.0E-12
sp|Q4A8A1|ECFA2_MYCH7 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain 7448) GN=ecfA2 PE=3 SV=1 875 1103 4.0E-12
sp|P54954|YXEO_BACSU Probable amino-acid import ATP-binding protein YxeO OS=Bacillus subtilis (strain 168) GN=yxeO PE=1 SV=1 886 1086 4.0E-12
sp|O69063|HTXD_PSEST Hypophosphite import ATP-binding protein HtxD OS=Pseudomonas stutzeri GN=htxD PE=3 SV=1 872 1123 4.0E-12
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 875 1068 4.0E-12
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 886 1086 4.0E-12
sp|Q9K789|METN_BACHD Methionine import ATP-binding protein MetN OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metN PE=3 SV=1 887 1068 5.0E-12
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 886 1108 6.0E-12
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 885 1135 6.0E-12
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 887 1067 7.0E-12
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 886 1108 8.0E-12
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 884 1086 8.0E-12
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 880 1090 1.0E-11
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 880 1090 1.0E-11
sp|P39456|TCYC_BACSU L-cystine import ATP-binding protein TcyC OS=Bacillus subtilis (strain 168) GN=tcyC PE=1 SV=4 886 1068 1.0E-11
sp|Q51719|YCOBA_PROFR Putative ABC transporter ATP-binding protein in cobA 5'region OS=Propionibacterium freudenreichii subsp. shermanii PE=3 SV=1 885 1068 1.0E-11
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 886 1108 1.0E-11
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 887 1095 1.0E-11
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 885 1086 2.0E-11
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 891 1105 2.0E-11
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 886 1086 2.0E-11
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 894 1067 3.0E-11
sp|Q724C0|METN1_LISMF Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN1 PE=3 SV=1 867 1086 3.0E-11
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 886 1086 3.0E-11
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 886 1108 4.0E-11
sp|Q0A8P9|LOLD_ALKEH Lipoprotein-releasing system ATP-binding protein LolD OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lolD PE=3 SV=1 886 1086 4.0E-11
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 876 1086 4.0E-11
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 886 1108 4.0E-11
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 886 1108 4.0E-11
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 886 1108 4.0E-11
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 886 1108 4.0E-11
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 886 1108 4.0E-11
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 183 428 4.0E-11
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 886 1108 4.0E-11
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 886 1108 4.0E-11
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 884 1086 4.0E-11
sp|Q92EZ6|METN1_LISIN Methionine import ATP-binding protein MetN 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN1 PE=3 SV=1 867 1086 4.0E-11
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 887 1086 5.0E-11
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 894 1067 5.0E-11
sp|Q8YA75|METN1_LISMO Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN1 PE=3 SV=1 867 1086 5.0E-11
sp|Q0BMC9|METN_FRATO Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metN PE=3 SV=1 876 1090 5.0E-11
sp|Q2A3Z2|METN_FRATH Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metN PE=3 SV=1 876 1090 5.0E-11
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 881 1103 7.0E-11
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 884 1086 7.0E-11
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 894 1093 7.0E-11
sp|Q3B276|LOLD2_CHLL7 Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lolD2 PE=3 SV=1 876 1067 8.0E-11
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 887 1086 9.0E-11
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 884 1072 9.0E-11
sp|Q2NHA1|ECFA_METST Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ecfA PE=3 SV=1 887 1067 9.0E-11
sp|Q9CIN4|METN_LACLA Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metN PE=3 SV=1 865 1072 1.0E-10
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 867 1068 1.0E-10
sp|Q73F11|METN1_BACC1 Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN1 PE=3 SV=1 894 1087 1.0E-10
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 857 1093 1.0E-10
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 857 1093 1.0E-10
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 857 1093 1.0E-10
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 867 1067 1.0E-10
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 884 1093 1.0E-10
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 887 1095 1.0E-10
sp|Q8G7F4|PSTB_BIFLO Phosphate import ATP-binding protein PstB OS=Bifidobacterium longum (strain NCC 2705) GN=pstB PE=3 SV=1 869 1094 1.0E-10
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 886 1086 1.0E-10
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 885 1086 1.0E-10
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 835 1072 1.0E-10
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 884 1097 2.0E-10
sp|Q89EW7|MODC2_BRADU Molybdenum import ATP-binding protein ModC 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=modC2 PE=3 SV=1 899 1095 2.0E-10
sp|Q82G23|PSTB_STRAW Phosphate import ATP-binding protein PstB OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pstB PE=3 SV=1 885 1104 2.0E-10
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 881 1105 2.0E-10
sp|Q7W148|PHNC_BORPA Phosphonates import ATP-binding protein PhnC OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=phnC PE=3 SV=1 886 1094 2.0E-10
sp|Q1GAN9|METN_LACDA Methionine import ATP-binding protein MetN OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=metN PE=3 SV=1 894 1095 2.0E-10
sp|Q49W48|METN_STAS1 Methionine import ATP-binding protein MetN OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metN PE=3 SV=1 878 1086 2.0E-10
sp|Q04B25|METN_LACDB Methionine import ATP-binding protein MetN OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=metN PE=3 SV=1 894 1095 2.0E-10
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 837 1072 2.0E-10
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 887 1086 2.0E-10
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 886 1093 2.0E-10
sp|Q7WNT8|PHNC_BORBR Phosphonates import ATP-binding protein PhnC OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=phnC PE=3 SV=1 886 1094 2.0E-10
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 881 1086 2.0E-10
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 866 1095 2.0E-10
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 442 711 3.0E-10
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 837 1072 3.0E-10
sp|Q03A07|METN_LACC3 Methionine import ATP-binding protein MetN OS=Lactobacillus casei (strain ATCC 334) GN=metN PE=3 SV=1 876 1072 3.0E-10
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 886 1086 3.0E-10
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 886 1086 3.0E-10
sp|A0LM36|MACB_SYNFM Macrolide export ATP-binding/permease protein MacB OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=macB PE=3 SV=1 886 1070 3.0E-10
sp|Q8DGZ3|PSTB_THEEB Phosphate import ATP-binding protein PstB OS=Thermosynechococcus elongatus (strain BP-1) GN=pstB PE=3 SV=1 885 1094 3.0E-10
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 887 1101 3.0E-10
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 887 1101 3.0E-10
sp|Q8Y0X3|METN_RALSO Methionine import ATP-binding protein MetN OS=Ralstonia solanacearum (strain GMI1000) GN=metN PE=3 SV=1 887 1095 3.0E-10
sp|P44662|Y361_HAEIN Probable iron transport system ATP-binding protein HI_0361 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0361 PE=3 SV=1 897 1072 3.0E-10
sp|P47311|Y065_MYCGE Putative ABC transporter ATP-binding protein MG065 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG065 PE=3 SV=1 886 1049 3.0E-10
sp|Q97KD5|METN_CLOAB Methionine import ATP-binding protein MetN OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=metN PE=3 SV=1 885 1072 3.0E-10
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 897 1097 3.0E-10
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 897 1054 3.0E-10
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 886 1086 3.0E-10
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 886 1086 3.0E-10
sp|O31711|YKNY_BACSU Uncharacterized ABC transporter ATP-binding protein YknY OS=Bacillus subtilis (strain 168) GN=yknY PE=1 SV=1 867 1069 3.0E-10
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 857 1093 3.0E-10
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 176 392 4.0E-10
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 846 1067 4.0E-10
sp|P75612|Y081_MYCPN Putative ABC transporter ATP-binding protein MG065 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_081 PE=3 SV=1 886 1086 4.0E-10
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 837 1072 4.0E-10
sp|Q5NHP2|LOLD_FRATT Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lolD PE=3 SV=1 886 1086 4.0E-10
sp|Q2A4V5|LOLD_FRATH Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lolD PE=3 SV=1 886 1086 4.0E-10
sp|Q14J44|LOLD_FRAT1 Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lolD PE=3 SV=1 886 1086 4.0E-10
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 841 1086 4.0E-10
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 887 1086 4.0E-10
sp|Q8G5P8|METN_BIFLO Methionine import ATP-binding protein MetN OS=Bifidobacterium longum (strain NCC 2705) GN=metN PE=3 SV=1 867 1095 4.0E-10
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 885 1086 4.0E-10
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 894 1097 4.0E-10
sp|A1JRI2|ZNUC_YERE8 Zinc import ATP-binding protein ZnuC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=znuC PE=3 SV=1 884 1073 5.0E-10
sp|Q6ME20|METN_PARUW Methionine import ATP-binding protein MetN OS=Protochlamydia amoebophila (strain UWE25) GN=metN PE=3 SV=1 887 1072 5.0E-10
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 887 1086 5.0E-10
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 897 1086 5.0E-10
sp|Q81PZ8|Y2641_BACAN Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1 884 1086 5.0E-10
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 884 1093 6.0E-10
sp|P42360|YSC1_STRGN Uncharacterized ABC transporter ATP-binding protein in scaA 5'region OS=Streptococcus gordonii PE=3 SV=1 887 1093 6.0E-10
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 881 1086 6.0E-10
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 821 1086 7.0E-10
sp|Q0BN75|LOLD_FRATO Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lolD PE=3 SV=1 886 1057 7.0E-10
sp|Q5FMM1|PHNC_LACAC Phosphonates import ATP-binding protein PhnC OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=phnC PE=3 SV=1 894 1111 7.0E-10
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 767 1086 7.0E-10
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 886 1108 7.0E-10
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 876 1101 7.0E-10
sp|Q7VI92|METN_HELHP Methionine import ATP-binding protein MetN OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=metN PE=3 SV=1 887 1112 7.0E-10
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 880 1087 7.0E-10
sp|Q5NFU5|METN_FRATT Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metN PE=3 SV=2 876 1090 8.0E-10
sp|Q608V9|MODC_METCA Molybdenum import ATP-binding protein ModC OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=modC PE=3 SV=1 896 1097 8.0E-10
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 886 1086 8.0E-10
sp|Q14H97|METN_FRAT1 Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=metN PE=3 SV=2 876 1090 8.0E-10
sp|Q6HI76|Y2424_BACHK Putative ABC transporter ATP-binding protein BT9727_2424 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2424 PE=3 SV=1 887 1086 9.0E-10
sp|Q9EUS2|PSTB_STRGR Phosphate import ATP-binding protein PstB OS=Streptomyces griseus GN=pstB PE=3 SV=1 885 1104 9.0E-10
sp|Q02ME3|METN1_PSEAB Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1 887 1097 9.0E-10
sp|Q12NL5|LOLD_SHEDO Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lolD PE=3 SV=1 885 1086 1.0E-09
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 885 1086 1.0E-09
sp|Q65M34|METN1_BACLD Methionine import ATP-binding protein MetN 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN1 PE=3 SV=1 881 1086 1.0E-09
sp|F8DT93|LOLD_ZYMMA Lipoprotein-releasing system ATP-binding protein LolD OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=lolD PE=3 SV=1 162 389 1.0E-09
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 885 1086 1.0E-09
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 884 1110 1.0E-09
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 887 1121 1.0E-09
sp|Q0AU85|METN_SYNWW Methionine import ATP-binding protein MetN OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=metN PE=3 SV=1 887 1095 1.0E-09
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 876 1067 1.0E-09
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 894 1093 1.0E-09
sp|Q6ADG4|PSTB_LEIXX Phosphate import ATP-binding protein PstB OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pstB PE=3 SV=1 894 1094 1.0E-09
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 880 1117 1.0E-09
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 867 1132 1.0E-09
sp|Q08381|MODC_RHOCA Molybdenum import ATP-binding protein ModC OS=Rhodobacter capsulatus GN=modC PE=3 SV=1 899 1095 1.0E-09
sp|Q8PGE8|METN_XANAC Methionine import ATP-binding protein MetN OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metN PE=3 SV=1 879 1097 1.0E-09
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 887 1086 1.0E-09
sp|Q6WB63|PHNC_ALCFA Phosphonates import ATP-binding protein PhnC OS=Alcaligenes faecalis GN=phnC PE=3 SV=1 885 1093 1.0E-09
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 179 391 2.0E-09
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 170 352 2.0E-09
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 170 352 2.0E-09
sp|P45769|YHDZ_ECOLI Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ OS=Escherichia coli (strain K12) GN=yhdZ PE=3 SV=1 885 1086 2.0E-09
sp|P0DJA1|LOLD_ZYMMO Lipoprotein-releasing system ATP-binding protein LolD OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lolD PE=3 SV=1 162 389 2.0E-09
sp|Q89LP2|METN_BRADU Methionine import ATP-binding protein MetN OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=metN PE=3 SV=1 887 1097 2.0E-09
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 894 1086 2.0E-09
sp|Q119J0|PHNC1_TRIEI Phosphonates import ATP-binding protein PhnC 1 OS=Trichodesmium erythraeum (strain IMS101) GN=phnC1 PE=3 SV=1 897 1092 2.0E-09
sp|Q4UMZ7|LOLD_RICFE Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lolD PE=3 SV=1 885 1086 2.0E-09
sp|Q032H3|ECFA2_LACLS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ecfA2 PE=3 SV=1 885 1067 2.0E-09
sp|Q8Y4L8|METN2_LISMO Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN2 PE=3 SV=1 887 1095 2.0E-09
sp|Q71X09|METN2_LISMF Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN2 PE=3 SV=1 887 1095 2.0E-09
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 887 1108 2.0E-09
sp|Q31VE6|NIKE_SHIBS Nickel import ATP-binding protein NikE OS=Shigella boydii serotype 4 (strain Sb227) GN=nikE PE=3 SV=1 880 1098 2.0E-09
sp|Q92AF9|MNTB_LISIN Manganese transport system ATP-binding protein MntB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntB PE=3 SV=1 887 1085 2.0E-09
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 867 1086 2.0E-09
sp|Q2J1U0|MODC_RHOP2 Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain HaA2) GN=modC PE=3 SV=1 899 1097 2.0E-09
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 881 1087 2.0E-09
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 884 1073 2.0E-09
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 884 1073 2.0E-09
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 884 1073 2.0E-09
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 884 1073 2.0E-09
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 880 1086 2.0E-09
sp|Q046T0|PHNC_LACGA Phosphonates import ATP-binding protein PhnC OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=phnC PE=3 SV=1 887 1119 2.0E-09
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 887 1109 2.0E-09
sp|A2RI02|ECFA2_LACLM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ecfA2 PE=1 SV=1 885 1067 2.0E-09
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 885 1086 2.0E-09
sp|Q0BZD8|PHNC_HYPNA Phosphonates import ATP-binding protein PhnC OS=Hyphomonas neptunium (strain ATCC 15444) GN=phnC PE=3 SV=1 894 1091 2.0E-09
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 894 1097 3.0E-09
sp|O34814|FTSE_BACSU Cell division ATP-binding protein FtsE OS=Bacillus subtilis (strain 168) GN=ftsE PE=1 SV=1 885 1072 3.0E-09
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 889 1086 3.0E-09
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 881 1088 3.0E-09
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 887 1093 3.0E-09
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 885 1086 3.0E-09
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 887 1067 3.0E-09
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 884 1093 3.0E-09
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 884 1093 3.0E-09
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 894 1086 3.0E-09
sp|P51241|ABCX_PORPU Probable ATP-dependent transporter ycf16 OS=Porphyra purpurea GN=ycf16 PE=3 SV=1 173 340 3.0E-09
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 835 1086 3.0E-09
sp|Q5ZUG5|METN_LEGPH Methionine import ATP-binding protein MetN OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=metN PE=3 SV=2 887 1090 3.0E-09
sp|Q8ELA5|METN4_OCEIH Methionine import ATP-binding protein MetN 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN4 PE=3 SV=1 880 1086 3.0E-09
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 868 1112 3.0E-09
sp|Q5MZ54|CMPC_SYNP6 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpC PE=3 SV=1 887 1086 3.0E-09
sp|Q55107|CMPC_SYNE7 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus elongatus (strain PCC 7942) GN=cmpC PE=1 SV=1 887 1086 3.0E-09
sp|Q9WYI7|Y352_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0352 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0352 PE=3 SV=1 883 1067 3.0E-09
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 887 1097 3.0E-09
sp|Q8X4L6|NIKE_ECO57 Nickel import ATP-binding protein NikE OS=Escherichia coli O157:H7 GN=nikE PE=3 SV=1 880 1098 3.0E-09
sp|Q7MJ01|LOLD_VIBVY Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio vulnificus (strain YJ016) GN=lolD PE=3 SV=2 867 1086 3.0E-09
sp|Q8DAV6|LOLD_VIBVU Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio vulnificus (strain CMCP6) GN=lolD PE=3 SV=1 867 1086 3.0E-09
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 886 1086 3.0E-09
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 897 1086 3.0E-09
sp|Q8E3S6|Y1680_STRA3 Putative ABC transporter ATP-binding protein gbs1680 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1680 PE=3 SV=1 868 1110 3.0E-09
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 897 1086 4.0E-09
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 887 1097 4.0E-09
sp|Q9PHQ1|PSTB_CAMJE Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pstB PE=3 SV=1 881 1065 4.0E-09
sp|P33594|NIKE_ECOLI Nickel import ATP-binding protein NikE OS=Escherichia coli (strain K12) GN=nikE PE=3 SV=2 880 1098 4.0E-09
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 889 1086 4.0E-09
sp|Q5FKL2|METN_LACAC Methionine import ATP-binding protein MetN OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=metN PE=3 SV=1 880 1072 4.0E-09
sp|Q32AQ1|NIKE_SHIDS Nickel import ATP-binding protein NikE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nikE PE=3 SV=1 880 1098 4.0E-09
sp|Q74LQ3|PHNC_LACJO Phosphonates import ATP-binding protein PhnC OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=phnC PE=3 SV=2 894 1119 4.0E-09
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 884 1086 4.0E-09
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 880 1053 4.0E-09
sp|Q8RQL7|GLUA_COREF Glutamate transport ATP-binding protein GluA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gluA PE=3 SV=1 894 1087 4.0E-09
sp|Q5WVL8|METN_LEGPL Methionine import ATP-binding protein MetN OS=Legionella pneumophila (strain Lens) GN=metN PE=3 SV=1 887 1090 4.0E-09
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 884 1086 5.0E-09
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 867 1095 5.0E-09
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 887 1086 5.0E-09
sp|Q20ZP0|PHNC1_RHOPB Phosphonates import ATP-binding protein PhnC 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=phnC1 PE=3 SV=1 894 1093 5.0E-09
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 886 1086 5.0E-09
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 868 1086 5.0E-09
sp|Q1R5D8|NIKE_ECOUT Nickel import ATP-binding protein NikE OS=Escherichia coli (strain UTI89 / UPEC) GN=nikE PE=3 SV=1 880 1098 5.0E-09
sp|Q8FCM9|NIKE_ECOL6 Nickel import ATP-binding protein NikE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nikE PE=3 SV=1 880 1098 5.0E-09
sp|Q0TBX8|NIKE_ECOL5 Nickel import ATP-binding protein NikE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nikE PE=3 SV=1 880 1098 5.0E-09
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 884 1090 5.0E-09
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 885 1086 5.0E-09
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 884 1086 6.0E-09
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 879 1072 6.0E-09
sp|Q92GP5|LOLD_RICCN Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lolD PE=3 SV=1 885 1080 6.0E-09
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 880 1086 6.0E-09
sp|Q6LN52|METN_PHOPR Methionine import ATP-binding protein MetN OS=Photobacterium profundum GN=metN PE=3 SV=2 887 1072 6.0E-09
sp|Q5X484|METN_LEGPA Methionine import ATP-binding protein MetN OS=Legionella pneumophila (strain Paris) GN=metN PE=3 SV=1 887 1090 6.0E-09
sp|O28882|LIVF_ARCFU Probable branched-chain amino acid transport ATP-binding protein LivF OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=livF PE=3 SV=1 167 400 6.0E-09
sp|Q5F6V6|MACB_NEIG1 Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=macB PE=3 SV=1 881 1069 6.0E-09
sp|Q5MK06|MACB_NEIGO Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae GN=macB PE=1 SV=1 881 1069 6.0E-09
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 894 1086 7.0E-09
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 868 1086 7.0E-09
sp|Q9K0N7|MACB_NEIMB Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup B (strain MC58) GN=macB PE=3 SV=1 881 1069 7.0E-09
sp|P54933|SMOK_RHOSH ATP-binding transport protein SmoK OS=Rhodobacter sphaeroides GN=smoK PE=3 SV=2 175 387 7.0E-09
sp|Q1XDP6|ABCX_PYRYE Probable ATP-dependent transporter ycf16 OS=Pyropia yezoensis GN=ycf16 PE=3 SV=1 175 340 7.0E-09
sp|Q7CHF8|METN2_YERPE Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis GN=metN2 PE=3 SV=1 887 1072 7.0E-09
sp|Q1C970|METN2_YERPA Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN2 PE=3 SV=1 887 1072 7.0E-09
sp|Q66CQ3|METN1_YERPS Methionine import ATP-binding protein MetN 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN1 PE=3 SV=1 887 1072 7.0E-09
sp|Q1CG91|METN1_YERPN Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN1 PE=3 SV=1 887 1072 7.0E-09
sp|Q3Z2L6|ZNUC_SHISS Zinc import ATP-binding protein ZnuC OS=Shigella sonnei (strain Ss046) GN=znuC PE=3 SV=1 877 1055 7.0E-09
sp|Q322E8|ZNUC_SHIBS Zinc import ATP-binding protein ZnuC OS=Shigella boydii serotype 4 (strain Sb227) GN=znuC PE=3 SV=1 877 1055 7.0E-09
sp|Q1RAS6|ZNUC_ECOUT Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain UTI89 / UPEC) GN=znuC PE=3 SV=1 877 1055 7.0E-09
sp|P0A9X1|ZNUC_ECOLI Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain K12) GN=znuC PE=1 SV=1 877 1055 7.0E-09
sp|P0A9X2|ZNUC_ECOL6 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=znuC PE=3 SV=1 877 1055 7.0E-09
sp|Q0TGX4|ZNUC_ECOL5 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=znuC PE=3 SV=1 877 1055 7.0E-09
sp|A1AC19|ZNUC_ECOK1 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O1:K1 / APEC GN=znuC PE=3 SV=1 877 1055 7.0E-09
sp|P0A9X3|ZNUC_ECO57 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O157:H7 GN=znuC PE=3 SV=1 877 1055 7.0E-09
sp|Q65TB7|LOLD_MANSM Lipoprotein-releasing system ATP-binding protein LolD OS=Mannheimia succiniciproducens (strain MBEL55E) GN=lolD PE=3 SV=1 885 1086 7.0E-09
sp|Q9I1C8|METN1_PSEAE Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN1 PE=3 SV=1 887 1097 7.0E-09
sp|P55662|Y4TH_RHISN Probable amino-acid ABC transporter ATP-binding protein y4tH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01510 PE=3 SV=1 886 1086 7.0E-09
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 867 1095 7.0E-09
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 884 1093 7.0E-09
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 884 1093 7.0E-09
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 152 463 8.0E-09
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 837 1097 8.0E-09
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 837 1097 8.0E-09
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 837 1097 8.0E-09
sp|Q1QVQ7|METN_CHRSD Methionine import ATP-binding protein MetN OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metN PE=3 SV=1 887 1097 8.0E-09
sp|Q2KVS6|MACB_BORA1 Macrolide export ATP-binding/permease protein MacB OS=Bordetella avium (strain 197N) GN=macB PE=3 SV=2 867 1086 8.0E-09
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 851 1094 8.0E-09
sp|Q8RD07|Y246_CALS4 Putative ABC transporter ATP-binding protein TTE0246 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0246 PE=3 SV=1 902 1093 8.0E-09
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 895 1086 9.0E-09
sp|Q8X5Q4|RBSA2_ECO57 Ribose import ATP-binding protein RbsA 2 OS=Escherichia coli O157:H7 GN=rbsA2 PE=3 SV=3 882 1086 9.0E-09
sp|Q32HA3|ZNUC_SHIDS Zinc import ATP-binding protein ZnuC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=znuC PE=3 SV=1 877 1055 9.0E-09
sp|O26096|METN_HELPY Methionine import ATP-binding protein MetN OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=metN PE=3 SV=1 894 1052 9.0E-09
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 886 1126 9.0E-09
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 867 1095 9.0E-09
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 897 1086 1.0E-08
sp|Q4KFA2|LOLD_PSEF5 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lolD PE=3 SV=2 894 1086 1.0E-08
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 886 1094 1.0E-08
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 887 1086 1.0E-08
sp|Q47C66|LOLD_DECAR Lipoprotein-releasing system ATP-binding protein LolD OS=Dechloromonas aromatica (strain RCB) GN=lolD PE=3 SV=1 886 1086 1.0E-08
sp|Q16BC5|PHNC1_ROSDO Phosphonates import ATP-binding protein PhnC 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=phnC1 PE=3 SV=1 887 1093 1.0E-08
sp|Q3YW48|NIKE_SHISS Nickel import ATP-binding protein NikE OS=Shigella sonnei (strain Ss046) GN=nikE PE=3 SV=1 880 1098 1.0E-08
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 867 1095 1.0E-08
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 876 1067 1.0E-08
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 876 1067 1.0E-08
sp|Q5HVF4|PSTB_CAMJR Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni (strain RM1221) GN=pstB PE=3 SV=1 881 1065 1.0E-08
sp|Q032D0|PHNC_LACLS Phosphonates import ATP-binding protein PhnC OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=phnC PE=3 SV=1 887 1104 1.0E-08
sp|Q895C4|METN_CLOTE Methionine import ATP-binding protein MetN OS=Clostridium tetani (strain Massachusetts / E88) GN=metN PE=3 SV=1 876 1095 1.0E-08
sp|Q0P9X7|PEB1C_CAMJE Probable ABC transporter ATP-binding protein PEB1C OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=peb1C PE=3 SV=1 886 1087 1.0E-08
sp|Q52666|BZTD_RHOCB Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=bztD PE=3 SV=2 885 1086 1.0E-08
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 876 1067 1.0E-08
sp|Q8DY60|Y1633_STRA5 Putative ABC transporter ATP-binding protein SAG1633 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=SAG1633 PE=3 SV=1 868 1110 1.0E-08
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 894 1086 1.0E-08
sp|Q88WA5|METN1_LACPL Methionine import ATP-binding protein MetN 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN1 PE=3 SV=1 894 1068 1.0E-08
sp|Q831K6|METN2_ENTFA Methionine import ATP-binding protein MetN 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metN2 PE=1 SV=1 887 1108 1.0E-08
sp|Q329G7|RBSA_SHIDS Ribose import ATP-binding protein RbsA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rbsA PE=3 SV=1 882 1086 1.0E-08
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 899 1091 2.0E-08
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 172 386 2.0E-08
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 896 1085 2.0E-08
sp|Q8YK28|PHNC3_NOSS1 Phosphonates import ATP-binding protein PhnC 3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=phnC3 PE=3 SV=1 895 1109 2.0E-08
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 884 1093 2.0E-08
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 183 386 2.0E-08
sp|Q2L219|LOLD_BORA1 Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella avium (strain 197N) GN=lolD PE=3 SV=1 885 1086 2.0E-08
sp|Q48PV0|ZNUC_PSE14 Zinc import ATP-binding protein ZnuC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=znuC PE=3 SV=1 876 1073 2.0E-08
sp|Q12B04|METN_POLSJ Methionine import ATP-binding protein MetN OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=metN PE=3 SV=1 887 1086 2.0E-08
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 837 1086 2.0E-08
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 887 1097 2.0E-08
sp|Q8CTB2|METN1_STAES Methionine import ATP-binding protein MetN 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=metN1 PE=3 SV=1 887 1086 2.0E-08
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 865 1067 2.0E-08
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 837 1086 2.0E-08
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 837 1086 2.0E-08
sp|A1VZQ5|PEB1C_CAMJJ Probable ABC transporter ATP-binding protein PEB1C OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=peb1C PE=3 SV=1 886 1087 2.0E-08
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 172 401 2.0E-08
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 887 1072 2.0E-08
sp|Q3SJC6|MODC_THIDA Molybdenum import ATP-binding protein ModC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=modC PE=3 SV=1 896 1098 2.0E-08
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 867 1093 2.0E-08
sp|Q6N798|METN2_RHOPA Methionine import ATP-binding protein MetN 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN2 PE=3 SV=1 886 1072 2.0E-08
sp|Q0I3C2|LOLD_HAES1 Lipoprotein-releasing system ATP-binding protein LolD OS=Haemophilus somnus (strain 129Pt) GN=lolD PE=3 SV=1 885 1086 2.0E-08
sp|Q63GR8|METN2_BACCZ Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ZK / E33L) GN=metN2 PE=3 SV=1 894 1086 2.0E-08
sp|Q5HQQ9|METN2_STAEQ Methionine import ATP-binding protein MetN 2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=metN2 PE=3 SV=1 887 1086 2.0E-08
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 877 1097 2.0E-08
sp|Q48KI4|LOLD_PSE14 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lolD PE=3 SV=1 894 1086 2.0E-08
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 852 1088 2.0E-08
sp|Q73EL7|METN2_BACC1 Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN2 PE=3 SV=1 894 1086 2.0E-08
sp|Q82HA2|Y3608_STRAW Putative ABC transporter ATP-binding protein SAV_3608 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_3608 PE=3 SV=1 890 1055 2.0E-08
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 869 1086 2.0E-08
sp|P96117|TROB_TREPA Zinc transport system ATP-binding protein TroB OS=Treponema pallidum (strain Nichols) GN=troB PE=3 SV=1 886 1083 2.0E-08
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 885 1106 2.0E-08
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 887 1086 2.0E-08
sp|Q7VZ31|LOLD_BORPE Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lolD PE=3 SV=1 886 1086 2.0E-08
sp|Q7W8T0|LOLD_BORPA Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lolD PE=3 SV=1 886 1086 2.0E-08
sp|Q7WK40|LOLD_BORBR Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lolD PE=3 SV=1 886 1086 2.0E-08
sp|Q52815|AAPP_RHIL3 General L-amino acid transport ATP-binding protein AapP OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aapP PE=3 SV=1 886 1086 3.0E-08
sp|Q8XNY7|Y195_CLOPE Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1 894 1097 3.0E-08
sp|Q47RE8|METN_THEFY Methionine import ATP-binding protein MetN OS=Thermobifida fusca (strain YX) GN=metN PE=3 SV=2 878 1072 3.0E-08
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 186 387 3.0E-08
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 877 1086 3.0E-08
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 186 387 3.0E-08
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 877 1086 3.0E-08
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 887 1097 3.0E-08
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 884 1073 3.0E-08
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 884 1073 3.0E-08
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 884 1073 3.0E-08
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 884 1073 3.0E-08
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 809 1086 3.0E-08
sp|P0A9S0|FTSE_SHIFL Cell division ATP-binding protein FtsE OS=Shigella flexneri GN=ftsE PE=3 SV=1 884 1086 3.0E-08
sp|P0A9R7|FTSE_ECOLI Cell division ATP-binding protein FtsE OS=Escherichia coli (strain K12) GN=ftsE PE=1 SV=1 884 1086 3.0E-08
sp|P0A9R8|FTSE_ECOL6 Cell division ATP-binding protein FtsE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ftsE PE=3 SV=1 884 1086 3.0E-08
sp|P0A9R9|FTSE_ECO57 Cell division ATP-binding protein FtsE OS=Escherichia coli O157:H7 GN=ftsE PE=3 SV=1 884 1086 3.0E-08
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 183 387 4.0E-08
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 176 452 9.0E-08
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 176 452 9.0E-08
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 176 452 9.0E-08
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 499 812 1.0E-07
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 884 1086 1.0E-07
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 183 386 2.0E-07
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 1182 1421 3.0E-07
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 175 392 4.0E-07
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 885 1086 4.0E-07
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 186 387 5.0E-07
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 186 387 5.0E-07
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 894 1067 7.0E-07
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 183 387 7.0E-07
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 183 387 8.0E-07
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 887 1086 8.0E-07
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 162 392 9.0E-07
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 176 463 1.0E-06
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 186 387 1.0E-06
sp|Q7MJ01|LOLD_VIBVY Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio vulnificus (strain YJ016) GN=lolD PE=3 SV=2 162 352 1.0E-06
sp|Q8DAV6|LOLD_VIBVU Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio vulnificus (strain CMCP6) GN=lolD PE=3 SV=1 162 352 1.0E-06
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 887 1067 2.0E-06
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 183 394 2.0E-06
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 176 365 3.0E-06
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 186 386 4.0E-06
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 186 457 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0042626 ATPase-coupled transmembrane transporter activity Yes
GO:0140359 ABC-type transporter activity Yes
GO:0016020 membrane Yes
GO:0005524 ATP binding Yes
GO:0031224 intrinsic component of membrane No
GO:0140657 ATP-dependent activity No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0022804 active transmembrane transporter activity No
GO:0051179 localization No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0005575 cellular_component No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 521 543 22
2 555 577 22
3 597 619 22
4 631 653 22
5 663 682 19
6 782 804 22
7 1207 1229 22
8 1294 1316 22
9 1331 1353 22
10 1360 1379 19
11 1389 1411 22
12 1481 1503 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8540
MYGINTNYDSTAASSGAPVETSHRPPGGDNDYEDDMEKRRDDVQASTGSSSPSETTPRKRRDAEMIRRSSVVQAL
ARSYSRASAVSGQNPFLAGPDSPLNPASANFSARQWARAVAELVTNNGGAFRSAGICFQNLNVYGYGESTDYQKD
VANTWLSLAGLVRRIAGSGRQRIDILRQFDGLVRRGEMLVVLGPPGSGCSTLLKTIAGEMNGIYVDDGSYFNYQG
MTAAEMHSRHRGEAIYTAEVDVHFPQLTVGDTLTFAARARQPRKLPEGLSRHGFADHLRDVVMAMFGISHTIDTR
VGNEYVRGVSGGERKRVTISEAALSGAALQCWDNSTRGLDSANAVEFCKTLRLQTELFSSTACVSIYQAPQSAYD
LFDKAVVLYEGRQIFFGRADAARQYFIDLGFECPPRQTTPDFLTSMTSSSERIVRPDFKGKTPRTPDEFAAAWRN
SAEYAALQDEIEDYKAAHPFDGPDAEAFRASRQAQQARGQRKKSPFTLSYSQQVRLCLWRGWKRLSGDPSLTVGS
LIGNSVMALIIGSVFYNLQDTTSSFFQRGALLFFACLMNAFASALEILTLYAQRPIVEKQSRYALYHPSAEAIAS
MLCDLPYKIVNSIIFNLIIYFMTNLRREPGAFFFFLLISFWTVLVMSMIFRFIGSASRSLFQALVPAAILILDLV
IFTGFVLPKRYMLGWSRWLNYIDPLGYAFESLMVNEFHGRRFRCTQYVPSANAPRPDLASALAQYANIGPENRVC
STVGSVRGDDFVNGDTYVKSSYDYEWGHRWRNLGIVIAFTVFFLICYMVAAELVSEKKSKGEVLVYRRGHKPAAV
KHAEKRHGDAEAAMANIGPIVTAERSRAEAKEGGILQQQTSVFQWHDVCYEVKVKGEMRRILDHVDGWVKPGTLT
ALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGKPRDMSFQRKTGYVQQQDLHLQTTTVREALNFSALLRQPAH
IPKEEKLAYVDEVIKLLDMDEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTSWAILN
LLERLTEAGQAVLCTIHQPSAVLFQRFDRLLFLAKGGKTVYFGDIGENSKTMINYFEQNGGHSCPAEANPAEWML
EVIGAAPGCSTDIDWFDTWRTSPEYQAVQAELEGTKKTKEDGVAATTTVTSDPGEYREFAAPFMEQLKENLFRVF
QQYWRTPVYIYSKTALCTLVALFIGFVFFKAPLSIQGLQNQMFALFQLLTVFGQIVQQSMPQFVIQRSLYEARER
PSKVYSWKVFMLSQIIVELPWNSLMAAIMYVCFYYPVGLYRNAEPTDAVAERGALVFLYLLAFMLFTGSFSTLVI
AGFETAEAGGNMANLMFTLCLIFCGVLATPETLPRFWIFLYRVSPFTYLVSGMLSAGIANVDVVCADNEVLHMSS
PANQTCGDYLNTFAQVAGGRVLNPAESGSCSYCPLRSTNSFLAAVSSNYTDRWRNFGLLWVYIGFNIVAALGVYW
LARVPKKGLGKGKKA
Coding >Ophio5|8540
ATGTACGGCATCAACACCAATTATGACTCGACGGCCGCCTCGAGCGGTGCGCCCGTCGAAACCTCGCACCGCCCC
CCCGGCGGCGATAACGACTACGAAGACGACATGGAGAAGCGAAGGGATGACGTCCAAGCCTCGACGGGCTCGTCG
TCACCTTCCGAGACAACGCCCCGCAAGCGTCGCGACGCTGAGATGATTCGCCGCTCCTCCGTCGTTCAGGCTCTC
GCGCGATCCTACTCGCGCGCCTCGGCCGTCTCGGGACAGAATCCCTTCCTCGCCGGACCAGACTCGCCGCTCAAT
CCGGCGTCGGCCAACTTCAGCGCCCGACAATGGGCCAGAGCCGTCGCCGAACTCGTCACCAATAACGGCGGCGCC
TTTCGCTCGGCCGGCATCTGCTTCCAGAATCTCAACGTCTACGGCTACGGCGAGTCGACCGACTACCAAAAGGAT
GTGGCCAATACTTGGTTGTCCCTCGCCGGCCTCGTTCGCCGAATCGCTGGCTCCGGGCGTCAGCGCATCGACATC
CTACGTCAGTTCGATGGGCTCGTCCGCAGGGGCGAGATGCTGGTCGTGCTCGGTCCGCCTGGCTCGGGCTGCTCG
ACGCTATTGAAGACGATTGCTGGCGAGATGAATGGCATCTATGTCGATGACGGCTCCTATTTTAACTACCAAGGA
ATGACGGCCGCCGAGATGCACTCAAGGCATCGTGGCGAGGCCATTTACACGGCAGAGGTCGACGTGCACTTCCCC
CAGTTGACGGTGGGCGATACCCTCACCTTTGCCGCGAGAGCCCGGCAGCCGCGCAAATTGCCCGAGGGTCTGAGC
AGACATGGCTTCGCCGACCACCTGCGCGATGTCGTCATGGCCATGTTCGGCATCTCGCACACCATCGACACGCGA
GTCGGTAATGAGTACGTCCGCGGCGTCTCGGGCGGCGAGCGTAAACGCGTCACCATTTCTGAGGCCGCTCTGTCC
GGTGCCGCTCTTCAGTGCTGGGATAATTCGACACGAGGCCTCGACTCGGCCAACGCCGTCGAGTTCTGCAAGACG
CTGCGTCTGCAGACGGAGCTGTTTAGCAGCACCGCCTGTGTCTCCATCTATCAGGCGCCGCAAAGCGCGTACGAC
CTATTTGACAAGGCCGTCGTACTCTACGAGGGCCGTCAGATCTTCTTTGGTCGCGCCGACGCTGCCAGGCAGTAC
TTCATCGACCTCGGCTTCGAGTGCCCGCCTCGCCAGACGACGCCCGACTTCCTCACCTCCATGACCTCCTCTTCC
GAGCGCATCGTCCGTCCAGATTTCAAAGGCAAGACGCCGCGTACGCCCGACGAGTTCGCCGCCGCGTGGAGGAAC
AGCGCCGAGTACGCCGCTCTCCAGGACGAGATCGAGGACTACAAGGCAGCCCATCCCTTCGACGGACCTGACGCA
GAGGCCTTTCGCGCCTCTCGCCAGGCCCAGCAGGCCAGGGGTCAGCGCAAGAAATCCCCGTTCACTCTGTCTTAT
AGCCAGCAGGTGCGCCTGTGTCTATGGCGCGGCTGGAAGCGCCTGAGCGGCGACCCGAGCCTGACTGTCGGGTCG
CTCATCGGAAACTCGGTCATGGCCTTGATTATTGGTAGTGTCTTTTATAATCTTCAGGATACCACGTCGAGCTTC
TTCCAGCGGGGGGCTCTGCTTTTCTTCGCCTGCCTCATGAATGCTTTTGCCTCGGCTCTCGAGATTCTCACCCTT
TACGCCCAACGGCCGATTGTAGAAAAACAAAGTCGTTACGCCCTCTATCACCCCTCGGCCGAGGCCATCGCCTCT
ATGCTCTGCGACCTGCCGTACAAGATCGTCAACTCCATCATCTTCAACCTCATCATCTACTTCATGACCAACCTC
CGGAGAGAGCCGGGTGCCTTCTTCTTCTTCCTGCTCATCTCCTTCTGGACCGTCCTCGTCATGAGCATGATCTTC
CGCTTCATCGGCTCGGCCTCGCGCTCGCTGTTCCAGGCCCTTGTGCCGGCCGCCATCTTGATCCTCGATCTCGTC
ATCTTCACTGGCTTCGTCCTGCCGAAACGCTACATGCTCGGATGGTCCCGGTGGCTCAACTACATCGATCCCTTG
GGCTACGCCTTCGAGTCGCTCATGGTCAACGAGTTCCACGGCCGCCGATTCAGATGCACCCAGTACGTGCCTTCG
GCCAACGCGCCCAGGCCCGATCTGGCGAGCGCCCTCGCCCAGTACGCCAACATCGGGCCCGAGAACCGCGTCTGC
AGTACCGTCGGCTCCGTCCGGGGAGACGATTTCGTCAACGGCGACACGTACGTCAAGTCGAGCTACGACTATGAA
TGGGGTCATCGGTGGCGCAACCTCGGCATCGTCATCGCCTTCACCGTCTTCTTCCTCATTTGCTACATGGTCGCC
GCCGAACTCGTTTCGGAGAAGAAGTCCAAGGGCGAGGTGCTCGTCTACCGGCGCGGCCACAAACCTGCGGCCGTC
AAACACGCCGAGAAGCGACATGGAGACGCCGAAGCCGCCATGGCCAACATTGGCCCGATCGTGACGGCTGAGAGG
AGCAGGGCCGAGGCCAAGGAGGGCGGCATCCTCCAGCAGCAGACGTCCGTCTTCCAGTGGCACGACGTCTGCTAC
GAAGTCAAGGTAAAGGGCGAGATGCGCCGCATCCTGGACCACGTCGACGGCTGGGTCAAGCCCGGCACCCTCACG
GCTCTCATGGGCGTGTCCGGTGCCGGCAAGACGACGCTGCTCGACTGTCTGGCCGACCGCACCTCGATGGGCGTC
ATCACGGGCGAGATGCTCGTCGACGGCAAACCCCGCGACATGTCTTTCCAGCGCAAGACGGGTTACGTCCAGCAG
CAGGACCTTCACTTGCAGACGACGACGGTCCGCGAGGCCCTCAACTTTAGCGCGCTCCTGCGCCAGCCCGCTCAC
ATACCCAAGGAGGAGAAGCTCGCCTACGTCGACGAGGTCATCAAGCTCCTCGACATGGACGAGTACGCAGACGCC
GTCGTCGGCGTTCCTGGCGAGGGCCTCAACGTAGAACAGCGCAAGCGTCTCACCATCGGGGTCGAGCTCGCCGCC
AAGCCCCCGCTGCTGCTCTTCGTCGACGAGCCCACCTCGGGCCTCGACTCGCAGACATCCTGGGCCATCCTTAAC
CTGCTGGAGAGGCTGACCGAGGCCGGCCAGGCTGTGCTCTGCACGATCCATCAGCCGTCGGCCGTACTCTTCCAG
CGCTTCGACCGGCTCCTCTTCCTGGCCAAGGGCGGCAAGACGGTCTACTTTGGCGACATTGGCGAAAACTCCAAG
ACGATGATCAACTACTTTGAGCAGAACGGCGGGCATAGCTGCCCGGCCGAGGCGAACCCGGCCGAGTGGATGCTC
GAGGTCATCGGGGCCGCTCCGGGATGCTCGACGGACATTGACTGGTTCGACACGTGGCGGACGAGCCCCGAGTAT
CAGGCGGTGCAGGCCGAGCTCGAGGGTACGAAGAAGACCAAGGAAGACGGGGTGGCGGCGACGACGACGGTAACG
TCGGACCCCGGCGAGTACCGCGAGTTTGCCGCGCCCTTCATGGAGCAGCTCAAGGAAAACCTGTTCCGCGTCTTC
CAGCAATACTGGCGGACCCCCGTCTACATCTACTCCAAGACGGCGCTCTGCACGCTCGTCGCCCTCTTCATCGGC
TTCGTCTTCTTCAAGGCGCCCCTCAGCATCCAGGGCCTGCAGAACCAGATGTTCGCCCTGTTCCAGCTGCTCACC
GTCTTCGGCCAGATCGTGCAACAGTCGATGCCGCAGTTTGTCATCCAGCGGTCGCTGTACGAGGCGCGCGAGCGG
CCTTCCAAGGTGTACTCTTGGAAGGTGTTCATGCTGTCGCAGATCATCGTCGAGCTGCCTTGGAACAGTCTGATG
GCGGCCATCATGTACGTCTGCTTCTACTACCCGGTCGGCCTCTACCGCAACGCCGAGCCGACCGACGCCGTGGCC
GAGCGGGGAGCGCTCGTCTTCCTCTACCTCCTGGCTTTTATGCTCTTCACCGGCTCCTTCTCGACGCTCGTCATC
GCCGGATTCGAGACGGCCGAGGCGGGCGGAAACATGGCCAACCTCATGTTTACGCTTTGCCTCATCTTCTGCGGC
GTGCTGGCGACGCCCGAGACGCTGCCTCGCTTCTGGATCTTCCTCTACCGCGTCTCGCCCTTTACCTACCTGGTG
TCGGGCATGCTGTCGGCCGGCATCGCCAACGTCGACGTCGTCTGCGCCGACAACGAGGTGCTGCACATGTCGTCG
CCCGCGAATCAGACCTGCGGAGACTACCTGAACACGTTTGCCCAGGTCGCGGGCGGCCGGGTCCTCAATCCGGCG
GAGTCGGGCTCATGCTCTTACTGTCCCCTAAGGAGCACCAACTCGTTCCTCGCCGCCGTCAGCAGCAATTATACC
GATCGGTGGAGGAACTTTGGCCTCCTTTGGGTTTACATTGGTTTCAACATTGTTGCGGCGCTAGGTGTCTATTGG
CTGGCGCGTGTGCCTAAGAAGGGGCTCGGCAAGGGGAAGAAGGCG
Transcript >Ophio5|8540
ATGTACGGCATCAACACCAATTATGACTCGACGGCCGCCTCGAGCGGTGCGCCCGTCGAAACCTCGCACCGCCCC
CCCGGCGGCGATAACGACTACGAAGACGACATGGAGAAGCGAAGGGATGACGTCCAAGCCTCGACGGGCTCGTCG
TCACCTTCCGAGACAACGCCCCGCAAGCGTCGCGACGCTGAGATGATTCGCCGCTCCTCCGTCGTTCAGGCTCTC
GCGCGATCCTACTCGCGCGCCTCGGCCGTCTCGGGACAGAATCCCTTCCTCGCCGGACCAGACTCGCCGCTCAAT
CCGGCGTCGGCCAACTTCAGCGCCCGACAATGGGCCAGAGCCGTCGCCGAACTCGTCACCAATAACGGCGGCGCC
TTTCGCTCGGCCGGCATCTGCTTCCAGAATCTCAACGTCTACGGCTACGGCGAGTCGACCGACTACCAAAAGGAT
GTGGCCAATACTTGGTTGTCCCTCGCCGGCCTCGTTCGCCGAATCGCTGGCTCCGGGCGTCAGCGCATCGACATC
CTACGTCAGTTCGATGGGCTCGTCCGCAGGGGCGAGATGCTGGTCGTGCTCGGTCCGCCTGGCTCGGGCTGCTCG
ACGCTATTGAAGACGATTGCTGGCGAGATGAATGGCATCTATGTCGATGACGGCTCCTATTTTAACTACCAAGGA
ATGACGGCCGCCGAGATGCACTCAAGGCATCGTGGCGAGGCCATTTACACGGCAGAGGTCGACGTGCACTTCCCC
CAGTTGACGGTGGGCGATACCCTCACCTTTGCCGCGAGAGCCCGGCAGCCGCGCAAATTGCCCGAGGGTCTGAGC
AGACATGGCTTCGCCGACCACCTGCGCGATGTCGTCATGGCCATGTTCGGCATCTCGCACACCATCGACACGCGA
GTCGGTAATGAGTACGTCCGCGGCGTCTCGGGCGGCGAGCGTAAACGCGTCACCATTTCTGAGGCCGCTCTGTCC
GGTGCCGCTCTTCAGTGCTGGGATAATTCGACACGAGGCCTCGACTCGGCCAACGCCGTCGAGTTCTGCAAGACG
CTGCGTCTGCAGACGGAGCTGTTTAGCAGCACCGCCTGTGTCTCCATCTATCAGGCGCCGCAAAGCGCGTACGAC
CTATTTGACAAGGCCGTCGTACTCTACGAGGGCCGTCAGATCTTCTTTGGTCGCGCCGACGCTGCCAGGCAGTAC
TTCATCGACCTCGGCTTCGAGTGCCCGCCTCGCCAGACGACGCCCGACTTCCTCACCTCCATGACCTCCTCTTCC
GAGCGCATCGTCCGTCCAGATTTCAAAGGCAAGACGCCGCGTACGCCCGACGAGTTCGCCGCCGCGTGGAGGAAC
AGCGCCGAGTACGCCGCTCTCCAGGACGAGATCGAGGACTACAAGGCAGCCCATCCCTTCGACGGACCTGACGCA
GAGGCCTTTCGCGCCTCTCGCCAGGCCCAGCAGGCCAGGGGTCAGCGCAAGAAATCCCCGTTCACTCTGTCTTAT
AGCCAGCAGGTGCGCCTGTGTCTATGGCGCGGCTGGAAGCGCCTGAGCGGCGACCCGAGCCTGACTGTCGGGTCG
CTCATCGGAAACTCGGTCATGGCCTTGATTATTGGTAGTGTCTTTTATAATCTTCAGGATACCACGTCGAGCTTC
TTCCAGCGGGGGGCTCTGCTTTTCTTCGCCTGCCTCATGAATGCTTTTGCCTCGGCTCTCGAGATTCTCACCCTT
TACGCCCAACGGCCGATTGTAGAAAAACAAAGTCGTTACGCCCTCTATCACCCCTCGGCCGAGGCCATCGCCTCT
ATGCTCTGCGACCTGCCGTACAAGATCGTCAACTCCATCATCTTCAACCTCATCATCTACTTCATGACCAACCTC
CGGAGAGAGCCGGGTGCCTTCTTCTTCTTCCTGCTCATCTCCTTCTGGACCGTCCTCGTCATGAGCATGATCTTC
CGCTTCATCGGCTCGGCCTCGCGCTCGCTGTTCCAGGCCCTTGTGCCGGCCGCCATCTTGATCCTCGATCTCGTC
ATCTTCACTGGCTTCGTCCTGCCGAAACGCTACATGCTCGGATGGTCCCGGTGGCTCAACTACATCGATCCCTTG
GGCTACGCCTTCGAGTCGCTCATGGTCAACGAGTTCCACGGCCGCCGATTCAGATGCACCCAGTACGTGCCTTCG
GCCAACGCGCCCAGGCCCGATCTGGCGAGCGCCCTCGCCCAGTACGCCAACATCGGGCCCGAGAACCGCGTCTGC
AGTACCGTCGGCTCCGTCCGGGGAGACGATTTCGTCAACGGCGACACGTACGTCAAGTCGAGCTACGACTATGAA
TGGGGTCATCGGTGGCGCAACCTCGGCATCGTCATCGCCTTCACCGTCTTCTTCCTCATTTGCTACATGGTCGCC
GCCGAACTCGTTTCGGAGAAGAAGTCCAAGGGCGAGGTGCTCGTCTACCGGCGCGGCCACAAACCTGCGGCCGTC
AAACACGCCGAGAAGCGACATGGAGACGCCGAAGCCGCCATGGCCAACATTGGCCCGATCGTGACGGCTGAGAGG
AGCAGGGCCGAGGCCAAGGAGGGCGGCATCCTCCAGCAGCAGACGTCCGTCTTCCAGTGGCACGACGTCTGCTAC
GAAGTCAAGGTAAAGGGCGAGATGCGCCGCATCCTGGACCACGTCGACGGCTGGGTCAAGCCCGGCACCCTCACG
GCTCTCATGGGCGTGTCCGGTGCCGGCAAGACGACGCTGCTCGACTGTCTGGCCGACCGCACCTCGATGGGCGTC
ATCACGGGCGAGATGCTCGTCGACGGCAAACCCCGCGACATGTCTTTCCAGCGCAAGACGGGTTACGTCCAGCAG
CAGGACCTTCACTTGCAGACGACGACGGTCCGCGAGGCCCTCAACTTTAGCGCGCTCCTGCGCCAGCCCGCTCAC
ATACCCAAGGAGGAGAAGCTCGCCTACGTCGACGAGGTCATCAAGCTCCTCGACATGGACGAGTACGCAGACGCC
GTCGTCGGCGTTCCTGGCGAGGGCCTCAACGTAGAACAGCGCAAGCGTCTCACCATCGGGGTCGAGCTCGCCGCC
AAGCCCCCGCTGCTGCTCTTCGTCGACGAGCCCACCTCGGGCCTCGACTCGCAGACATCCTGGGCCATCCTTAAC
CTGCTGGAGAGGCTGACCGAGGCCGGCCAGGCTGTGCTCTGCACGATCCATCAGCCGTCGGCCGTACTCTTCCAG
CGCTTCGACCGGCTCCTCTTCCTGGCCAAGGGCGGCAAGACGGTCTACTTTGGCGACATTGGCGAAAACTCCAAG
ACGATGATCAACTACTTTGAGCAGAACGGCGGGCATAGCTGCCCGGCCGAGGCGAACCCGGCCGAGTGGATGCTC
GAGGTCATCGGGGCCGCTCCGGGATGCTCGACGGACATTGACTGGTTCGACACGTGGCGGACGAGCCCCGAGTAT
CAGGCGGTGCAGGCCGAGCTCGAGGGTACGAAGAAGACCAAGGAAGACGGGGTGGCGGCGACGACGACGGTAACG
TCGGACCCCGGCGAGTACCGCGAGTTTGCCGCGCCCTTCATGGAGCAGCTCAAGGAAAACCTGTTCCGCGTCTTC
CAGCAATACTGGCGGACCCCCGTCTACATCTACTCCAAGACGGCGCTCTGCACGCTCGTCGCCCTCTTCATCGGC
TTCGTCTTCTTCAAGGCGCCCCTCAGCATCCAGGGCCTGCAGAACCAGATGTTCGCCCTGTTCCAGCTGCTCACC
GTCTTCGGCCAGATCGTGCAACAGTCGATGCCGCAGTTTGTCATCCAGCGGTCGCTGTACGAGGCGCGCGAGCGG
CCTTCCAAGGTGTACTCTTGGAAGGTGTTCATGCTGTCGCAGATCATCGTCGAGCTGCCTTGGAACAGTCTGATG
GCGGCCATCATGTACGTCTGCTTCTACTACCCGGTCGGCCTCTACCGCAACGCCGAGCCGACCGACGCCGTGGCC
GAGCGGGGAGCGCTCGTCTTCCTCTACCTCCTGGCTTTTATGCTCTTCACCGGCTCCTTCTCGACGCTCGTCATC
GCCGGATTCGAGACGGCCGAGGCGGGCGGAAACATGGCCAACCTCATGTTTACGCTTTGCCTCATCTTCTGCGGC
GTGCTGGCGACGCCCGAGACGCTGCCTCGCTTCTGGATCTTCCTCTACCGCGTCTCGCCCTTTACCTACCTGGTG
TCGGGCATGCTGTCGGCCGGCATCGCCAACGTCGACGTCGTCTGCGCCGACAACGAGGTGCTGCACATGTCGTCG
CCCGCGAATCAGACCTGCGGAGACTACCTGAACACGTTTGCCCAGGTCGCGGGCGGCCGGGTCCTCAATCCGGCG
GAGTCGGGCTCATGCTCTTACTGTCCCCTAAGGAGCACCAACTCGTTCCTCGCCGCCGTCAGCAGCAATTATACC
GATCGGTGGAGGAACTTTGGCCTCCTTTGGGTTTACATTGGTTTCAACATTGTTGCGGCGCTAGGTGTCTATTGG
CTGGCGCGTGTGCCTAAGAAGGGGCTCGGCAAGGGGAAGAAGGCGTGA
Gene >Ophio5|8540
ATGTACGGCATCAACACCAATTATGACTCGACGGCCGCCTCGAGCGGTGCGCCCGTCGAAACCTCGCACCGCCCC
CCCGGCGGCGATAACGACTACGAAGACGACATGGAGAAGCGAAGGGATGACGTCCAAGCCTCGACGGGCTCGTCG
TCACCTTCCGAGACAACGCCCCGCAAGCGTCGCGACGCTGAGATGATTCGCCGCTCCTCCGTCGTTCAGGCTCTC
GCGCGATCCTACTCGCGCGCCTCGGCCGTCTCGGGACAGAATCCCTTCCTCGCCGGACCAGACTCGCCGCTCAAT
CCGGCGTCGGCCAACTTCAGCGCCCGACAATGGGCCAGAGCCGTCGCCGAACTCGTCACCAATAACGGCGGCGCC
TTTCGCTCGGCCGGCATCTGCTTCCAGAATCTCAACGTCTACGGCTACGGCGAGTCGACCGACTACCAAAAGGAT
GTGGCCAATACTTGGTTGTCCCTCGCCGGCCTCGTTCGCCGAATCGCTGGCTCCGGGCGTCAGCGCATCGACATC
CTACGTCAGTTCGATGGGCTCGTCCGCAGGGGCGAGATGCTGGTCGTGCTCGGTCCGCCTGGCTCGGGCTGCTCG
ACGCTATTGAAGACGATTGCTGGCGAGATGAATGGCATCTATGTCGATGACGGCTCCTATTTTAACTACCAAGGT
ATGTGCAATGTGACGGTACGGATCTTGCCGCGCCTGGCCCGGATCTGCGGCGCCAAAGTTTTTCACTTGTTTAAA
CCCAATAACCTTGTACGAGAACAACATAGCCGCGTATGCGGGGAGACGTGGGTCCATCGGAAGAAGCCGTCTCGG
CTGACATAATCACCAGGAATGACGGCCGCCGAGATGCACTCAAGGCATCGTGGCGAGGCCATTTACACGGCAGAG
GTCGACGTGCACTTCCCCCAGTTGACGGTGGGCGATACCCTCACCTTTGCCGCGAGAGCCCGGCAGCCGCGCAAA
TTGCCCGAGGGTCTGAGCAGACATGGCTTCGCCGACCACCTGCGCGATGTCGTCATGGCCATGTTCGGCATCTCG
CACACCATCGACACGCGAGTCGGTAATGAGTACGTCCGCGGCGTCTCGGGCGGCGAGCGTAAACGCGTCACCATT
TCTGAGGCCGCTCTGTCCGGTGCCGCTCTTCAGTGCTGGGATAATTCGACACGAGGCCTCGACTCGGCCAACGCC
GTCGAGTTCTGCAAGACGCTGCGTCTGCAGACGGAGCTGTTTAGCAGCACCGCCTGTGTCTCCATCTATCAGGCG
CCGCAAAGCGCGTACGACCTATTTGACAAGGCCGTCGTACTCTACGAGGGCCGTCAGATCTTCTTTGGTCGCGCC
GACGCTGCCAGGCAGTACTTCATCGACCTCGGCTTCGAGTGCCCGCCTCGCCAGACGACGCCCGACTTCCTCACC
TCCATGACCTCCTCTTCCGAGCGCATCGTCCGTCCAGATTTCAAAGGCAAGACGCCGCGTACGCCCGACGAGTTC
GCCGCCGCGTGGAGGAACAGCGCCGAGTACGCCGCTCTCCAGGACGAGATCGAGGACTACAAGGCAGCCCATCCC
TTCGACGGACCTGACGCAGAGGCCTTTCGCGCCTCTCGCCAGGCCCAGCAGGCCAGGGGTCAGCGCAAGAAATCC
CCGTTCACTCTGTCTTATAGCCAGCAGGTGCGCCTGTGTCTATGGCGCGGCTGGAAGCGCCTGAGCGGCGACCCG
AGCCTGACTGTCGGGTCGCTCATCGGAAACTCGGTCATGGCCTTGATTATTGGTAGTGTCTTTTATAATCTTCAG
GATACCACGTCGAGCTTCTTCCAGCGGGGGGCTCTGCTTTTCTTCGCCTGCCTCATGAATGCTTTTGCCTCGGCT
CTCGAGGTTCGTCACCCCCCTTTCTCGACATATCGTCGTTTCACCCGAATCTGACAAAAACTGCAGATTCTCACC
CTTTACGCCCAACGGCCGATTGTAGAAAAACAAAGTCGTTACGCCCTCTATCACCCCTCGGCCGAGGCCATCGCC
TCTATGCTCTGCGACCTGCCGTACAAGATCGTCAACTCCATCATCTTCAACCTCATCATCTACTTCATGACCAAC
CTCCGGAGAGAGCCGGGTGCCTTCTTCTTCTTCCTGCTCATCTCCTTCTGGACCGTCCTCGTCATGAGCATGATC
TTCCGCTTCATCGGCTCGGCCTCGCGCTCGCTGTTCCAGGCCCTTGTGCCGGCCGCCATCTTGATCCTCGATCTC
GTCATCTTCACTGGCTTCGTCCTGCCGAAACGCTACATGCTCGGATGGTCCCGGTGGCTCAACTACATCGATCCC
TTGGGCTACGCCTTCGAGTCGCTCATGGTCAACGAGTTCCACGGCCGCCGATTCAGATGCACCCAGTACGTGCCT
TCGGCCAACGCGCCCAGGCCCGATCTGGCGAGCGCCCTCGCCCAGTACGCCAACATCGGGCCCGAGAACCGCGTC
TGCAGTACCGTCGGCTCCGTCCGGGGAGACGATTTCGTCAACGGCGACACGTACGTCAAGTCGAGCTACGACTAT
GAATGGGGTCATCGGTGGCGCAACCTCGGCATCGTCATCGCCTTCACCGTCTTCTTCCTCATTTGCTACATGGTC
GCCGCCGAACTCGTTTCGGAGAAGAAGTCCAAGGGCGAGGTGCTCGTCTACCGGCGCGGCCACAAACCTGCGGCC
GTCAAACACGCCGAGAAGCGACATGGAGACGCCGAAGCCGCCATGGCCAACATTGGCCCGATCGTGACGGCTGAG
AGGAGCAGGGCCGAGGCCAAGGAGGGCGGCATCCTCCAGCAGCAGACGTCCGTCTTCCAGTGGCACGACGTCTGC
TACGAAGTCAAGGTAAAGGGCGAGATGCGCCGCATCCTGGACCACGTCGACGGCTGGGTCAAGCCCGGCACCCTC
ACGGCTCTCATGGGCGTGTCCGGTGCCGGCAAGACGACGCTGCTCGACTGTCTGGCCGACCGCACCTCGATGGGC
GTCATCACGGGCGAGATGCTCGTCGACGGCAAACCCCGCGACATGTCTTTCCAGCGCAAGACGGGTTACGTCCAG
CAGCAGGACCTTCACTTGCAGACGACGACGGTCCGCGAGGCCCTCAACTTTAGCGCGCTCCTGCGCCAGCCCGCT
CACATACCCAAGGAGGAGAAGCTCGCCTACGTCGACGAGGTCATCAAGCTCCTCGACATGGACGAGTACGCAGAC
GCCGTCGTCGGCGTTCCTGGCGAGGGCCTCAACGTAGAACAGCGCAAGCGTCTCACCATCGGGGTCGAGCTCGCC
GCCAAGCCCCCGCTGCTGCTCTTCGTCGACGAGCCCACCTCGGGCCTCGACTCGCAGACATCCTGGGCCATCCTT
AACCTGCTGGAGAGGCTGACCGAGGCCGGCCAGGCTGTGCTCTGCACGATCCATCAGCCGTCGGCCGTACTCTTC
CAGCGCTTCGACCGGCTCCTCTTCCTGGCCAAGGGCGGCAAGACGGTCTACTTTGGCGACATTGGCGAAAACTCC
AAGACGATGATCAACTACTTTGAGCAGAACGGCGGGCATAGCTGCCCGGCCGAGGCGAACCCGGCCGAGTGGATG
CTCGAGGTCATCGGGGCCGCTCCGGGATGCTCGACGGACATTGACTGGTTCGACACGTGGCGGACGAGCCCCGAG
TATCAGGCGGTGCAGGCCGAGCTCGAGGGTACGAAGAAGACCAAGGAAGACGGGGTGGCGGCGACGACGACGGTA
ACGTCGGACCCCGGCGAGTACCGCGAGTTTGCCGCGCCCTTCATGGAGCAGCTCAAGGAAAACCTGTTCCGCGTC
TTCCAGCAATACTGGCGGACCCCCGTCTACATCTACTCCAAGACGGCGCTCTGCACGCTCGTCGCCCTCTTCATC
GGCTTCGTCTTCTTCAAGGCGCCCCTCAGCATCCAGGGCCTGCAGAACCAGATGTTCGCCCTGTTCCAGCTGCTC
ACCGTCTTCGGCCAGATCGTGCAACAGTCGATGCCGCAGTTTGTCATCCAGCGGTCGCTGTACGAGGCGCGCGAG
CGGCCTTCCAAGGTGTACTCTTGGAAGGTGTTCATGCTGTCGCAGATCATCGTCGAGCTGCCTTGGAACAGTCTG
ATGGCGGCCATCATGTACGTCTGCTTCTACTACCCGGTCGGCCTCTACCGCAACGCCGAGCCGACCGACGCCGTG
GCCGAGCGGGGAGCGCTCGTCTTCCTCTACCTCCTGGCTTTTATGCTCTTCACCGGCTCCTTCTCGACGCTCGTC
ATCGCCGGATTCGAGACGGCCGAGGCGGGCGGAAACATGGCCAACCTCATGTTTACGCTTTGCCTCATCTTCTGC
GGCGTGCTGGCGACGCCCGAGACGCTGCCTCGCTTCTGGATCTTCCTCTACCGCGTCTCGCCCTTTACCTACCTG
GTGTCGGGCATGCTGTCGGCCGGCATCGCCAACGTCGACGTCGTCTGCGCCGACAACGAGGTGCTGCACATGTCG
TCGCCCGCGAATCAGACCTGCGGAGACTACCTGAACACGTTTGCCCAGGTCGCGGGCGGCCGGGTCCTCAATCCG
GCGGAGTCGGGCTCATGCTCTTACTGTCCCCTAAGGAGCACCAACTCGTTCCTCGCCGCCGTCAGCAGCAATTAT
ACCGATCGGTGGAGGAACTTTGGCCTCCTTTGGGTTTACATTGGTTTCAACATTGTTGCGGCGCTAGGTGTCTAT
TGGCTGGCGCGTGTGCCTAAGAAGGGGCTCGGCAAGGGGAAGAAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail