Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8535
Gene name
Locationscaffold_969:87..2670
Strand-
Gene length (bp)2583
Transcript length (bp)2583
Coding sequence length (bp)2580
Protein length (aa) 860

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 3.7E-20 444 722

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54496|YQGS_BACSU Lipoteichoic acid synthase-like YqgS OS=Bacillus subtilis (strain 168) GN=yqgS PE=3 SV=2 561 742 1.0E-07
sp|O32206|YVGJ_BACSU Lipoteichoic acid synthase-like YvgJ OS=Bacillus subtilis (strain 168) GN=yvgJ PE=3 SV=1 600 740 2.0E-06
sp|O34952|LTAS2_BACSU Lipoteichoic acid synthase 2 OS=Bacillus subtilis (strain 168) GN=ltaS2 PE=1 SV=1 568 722 2.0E-06
sp|P0AD27|YEJM_ECOLI Inner membrane protein YejM OS=Escherichia coli (strain K12) GN=yejM PE=1 SV=1 633 776 3.0E-06
sp|P0AD28|YEJM_ECOL6 Inner membrane protein YejM OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yejM PE=3 SV=1 633 776 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54496|YQGS_BACSU Lipoteichoic acid synthase-like YqgS OS=Bacillus subtilis (strain 168) GN=yqgS PE=3 SV=2 561 742 1.0E-07
sp|O32206|YVGJ_BACSU Lipoteichoic acid synthase-like YvgJ OS=Bacillus subtilis (strain 168) GN=yvgJ PE=3 SV=1 600 740 2.0E-06
sp|O34952|LTAS2_BACSU Lipoteichoic acid synthase 2 OS=Bacillus subtilis (strain 168) GN=ltaS2 PE=1 SV=1 568 722 2.0E-06
sp|P0AD27|YEJM_ECOLI Inner membrane protein YejM OS=Escherichia coli (strain K12) GN=yejM PE=1 SV=1 633 776 3.0E-06
sp|P0AD28|YEJM_ECOL6 Inner membrane protein YejM OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yejM PE=3 SV=1 633 776 3.0E-06
sp|P0AD29|YEJM_ECO57 Inner membrane protein YejM OS=Escherichia coli O157:H7 GN=yejM PE=3 SV=1 633 776 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 67 89 22
3 109 131 22
4 146 168 22
5 248 267 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8535
MIYRLLGRPQAVPPPPGPSFAASVILYLFNRRVFSLSRYVFSIFAVAVFGAKLVHIYAHVDAMASDLLGYGMSFF
AQDVLFLVMMRLLLDNISSLNIRCLRILAISLSSILVASTLFFASVSISFFVVTGTELRWRNVGVASDSAAWGML
LSGLFSCSVVGASILLVAWLAQDLVANVFGAILNLVRWPFSLALSKIAPRAPSLPLAYQHIPQDDVEDASGERKL
LAVDDAQQVPVSADDESQKRPSLCLHVSLAITLIIIAISTIARPVDSSLIFMSWTLPLVPFIDLLPSSPSVAGLV
PSYGNDVNSDLENRTALAEPPSWTWLPEGETLPGFEDWYEGKDHYRADKDPLRVSNLNSALLPELRHSLSDVKIR
HVVLIKLESTRKDVFPIKKGGYIWETLAASHDNNTLPSSAVDLFSKLTPNANYLTGDFDDGFAHAKTKPRGGINA
NNVHTTSTYTLKSLAGTLCGLYPLVADFNREYETHVYQPCLSHIFNAFNALEKDQDDGGSSDDFSSFKWRSTFMQ
SVTDGYDKQNAEMPVLGYPEGFFLSKEILQSGEGKFGKINVSDINYYGMSEEVLKDYVREEFAAAKKDNGRVFLS
HLTSTTHHPFVLPEGENYLPLTDDKKLNDLSHYVNTIGFADQWLGQILEVLEEEGVADETLVVLVGDHGLSLPEN
GGVTPYYNGNVGNFHVPLVLSHPSLPAIDVNDAAASLSILPTILDLLVETGSLSKTTKQAAQDLMKNYEGQSLLR
PQRQASWETGESNWLFTVMNPGRATVAIRDAHRPDWRLIMPVIDDVEWRFTNTAEDPHEMEPVISFSFAPLLEKI
ERKHGVEAATWAETAAFKAQWWVKENNKRWRFDAK
Coding >Ophio5|8535
ATGATCTACCGTCTCCTCGGCCGCCCTCAGGCCGTGCCGCCTCCCCCAGGCCCGTCCTTTGCCGCCTCCGTCATC
CTCTACCTCTTCAACAGACGCGTCTTCTCCCTTTCTCGCTATGTCTTCTCCATCTTCGCCGTGGCCGTGTTCGGC
GCCAAGCTGGTGCACATCTACGCCCATGTTGATGCCATGGCCTCGGATCTCCTCGGCTACGGCATGTCCTTCTTC
GCCCAGGACGTCTTATTCCTCGTCATGATGCGCCTGCTGCTCGACAACATATCCTCACTCAACATCCGCTGCCTC
CGCATCCTGGCAATCTCTCTGAGCTCCATCCTCGTTGCCTCGACCCTCTTCTTCGCCTCCGTCAGCATATCCTTC
TTCGTCGTCACGGGCACGGAGCTCCGCTGGCGTAACGTTGGCGTGGCCAGCGATTCAGCCGCCTGGGGCATGCTG
CTCTCCGGGCTCTTCTCCTGCAGTGTCGTCGGCGCTTCCATCCTTCTCGTTGCCTGGCTGGCGCAGGACCTGGTT
GCCAACGTCTTCGGCGCCATCCTCAACCTTGTCAGATGGCCCTTCTCCCTGGCTCTGAGCAAGATTGCGCCCCGA
GCTCCGTCTCTTCCCCTGGCATATCAGCACATCCCGCAGGACGACGTTGAGGATGCTTCCGGCGAACGCAAGCTT
CTGGCAGTCGACGATGCTCAACAGGTCCCTGTTTCTGCCGATGACGAGTCTCAGAAACGGCCGTCCCTGTGCCTG
CATGTTAGTCTCGCCATCACTCTCATCATCATTGCCATCTCGACCATTGCCCGCCCCGTTGATAGCTCCCTGATC
TTCATGTCGTGGACGCTGCCCCTGGTGCCCTTCATCGACCTGCTGCCTTCGTCGCCCAGCGTCGCCGGCCTGGTC
CCTTCGTATGGCAACGACGTCAATAGCGACTTGGAGAACCGGACGGCGCTCGCGGAACCCCCGTCTTGGACCTGG
CTGCCCGAGGGCGAGACGCTTCCGGGCTTCGAGGACTGGTACGAGGGCAAGGACCACTATCGCGCGGACAAGGAC
CCCCTTCGCGTCTCCAACCTCAACTCGGCCTTGCTGCCGGAGCTCAGACACAGCCTCAGCGACGTCAAGATTCGT
CACGTTGTCCTCATCAAGCTCGAGAGTACCCGCAAGGACGTTTTCCCCATTAAGAAGGGAGGCTACATCTGGGAG
ACACTCGCGGCCAGCCATGACAACAACACACTGCCCAGCAGTGCCGTCGACCTCTTCTCCAAGCTTACGCCCAAC
GCAAACTATCTGACAGGGGACTTCGACGACGGCTTCGCTCACGCCAAAACGAAGCCGCGCGGTGGCATCAACGCC
AACAACGTCCACACCACCAGCACCTACACACTCAAGAGCTTAGCCGGCACCCTCTGTGGTCTGTATCCGCTCGTG
GCCGACTTCAACCGTGAGTACGAGACGCACGTGTACCAGCCGTGTCTATCGCACATCTTCAACGCCTTCAACGCG
CTGGAGAAGGACCAAGACGATGGCGGCTCGAGCGACGACTTTAGCTCGTTCAAGTGGAGGTCGACGTTTATGCAG
TCCGTCACCGACGGCTACGACAAGCAGAACGCCGAGATGCCCGTCTTAGGCTACCCCGAGGGCTTCTTCCTCAGC
AAGGAGATTCTACAGAGCGGCGAGGGCAAGTTTGGCAAGATTAACGTGTCCGACATCAACTACTACGGCATGTCG
GAAGAGGTGCTCAAGGACTACGTCCGCGAGGAGTTTGCGGCGGCCAAGAAGGACAATGGACGCGTCTTCCTGTCG
CATCTGACAAGCACCACGCATCACCCGTTTGTCCTGCCTGAAGGCGAAAACTATCTACCGCTCACGGACGACAAG
AAGCTCAACGACTTGTCGCACTACGTCAACACTATTGGGTTCGCCGACCAATGGCTGGGCCAGATTCTCGAGGTC
CTGGAAGAGGAGGGCGTTGCCGACGAGACTCTTGTCGTCCTCGTCGGCGACCACGGCCTCTCGCTGCCGGAGAAT
GGGGGTGTGACGCCCTATTATAACGGCAACGTGGGCAACTTCCACGTGCCCCTGGTGCTCTCCCACCCATCGTTG
CCGGCCATCGACGTCAACGACGCGGCGGCATCCCTTTCGATCCTGCCGACGATTCTCGACCTTCTAGTTGAGACG
GGCTCTCTCTCCAAGACGACGAAACAGGCGGCGCAAGACCTGATGAAGAACTACGAGGGACAGTCGCTGCTCCGG
CCTCAGCGCCAAGCCTCATGGGAGACGGGCGAGTCCAACTGGCTCTTCACAGTGATGAACCCTGGCCGGGCAACG
GTGGCGATCCGCGACGCTCACCGACCGGACTGGCGGCTCATTATGCCCGTCATCGACGACGTCGAGTGGCGCTTC
ACCAACACGGCCGAGGATCCGCACGAGATGGAGCCCGTCATCTCCTTCTCCTTTGCCCCATTACTCGAGAAGATT
GAGCGCAAGCATGGCGTCGAGGCCGCGACGTGGGCCGAGACGGCCGCCTTCAAGGCCCAGTGGTGGGTCAAGGAA
AACAACAAGCGGTGGCGCTTCGATGCCAAA
Transcript >Ophio5|8535
ATGATCTACCGTCTCCTCGGCCGCCCTCAGGCCGTGCCGCCTCCCCCAGGCCCGTCCTTTGCCGCCTCCGTCATC
CTCTACCTCTTCAACAGACGCGTCTTCTCCCTTTCTCGCTATGTCTTCTCCATCTTCGCCGTGGCCGTGTTCGGC
GCCAAGCTGGTGCACATCTACGCCCATGTTGATGCCATGGCCTCGGATCTCCTCGGCTACGGCATGTCCTTCTTC
GCCCAGGACGTCTTATTCCTCGTCATGATGCGCCTGCTGCTCGACAACATATCCTCACTCAACATCCGCTGCCTC
CGCATCCTGGCAATCTCTCTGAGCTCCATCCTCGTTGCCTCGACCCTCTTCTTCGCCTCCGTCAGCATATCCTTC
TTCGTCGTCACGGGCACGGAGCTCCGCTGGCGTAACGTTGGCGTGGCCAGCGATTCAGCCGCCTGGGGCATGCTG
CTCTCCGGGCTCTTCTCCTGCAGTGTCGTCGGCGCTTCCATCCTTCTCGTTGCCTGGCTGGCGCAGGACCTGGTT
GCCAACGTCTTCGGCGCCATCCTCAACCTTGTCAGATGGCCCTTCTCCCTGGCTCTGAGCAAGATTGCGCCCCGA
GCTCCGTCTCTTCCCCTGGCATATCAGCACATCCCGCAGGACGACGTTGAGGATGCTTCCGGCGAACGCAAGCTT
CTGGCAGTCGACGATGCTCAACAGGTCCCTGTTTCTGCCGATGACGAGTCTCAGAAACGGCCGTCCCTGTGCCTG
CATGTTAGTCTCGCCATCACTCTCATCATCATTGCCATCTCGACCATTGCCCGCCCCGTTGATAGCTCCCTGATC
TTCATGTCGTGGACGCTGCCCCTGGTGCCCTTCATCGACCTGCTGCCTTCGTCGCCCAGCGTCGCCGGCCTGGTC
CCTTCGTATGGCAACGACGTCAATAGCGACTTGGAGAACCGGACGGCGCTCGCGGAACCCCCGTCTTGGACCTGG
CTGCCCGAGGGCGAGACGCTTCCGGGCTTCGAGGACTGGTACGAGGGCAAGGACCACTATCGCGCGGACAAGGAC
CCCCTTCGCGTCTCCAACCTCAACTCGGCCTTGCTGCCGGAGCTCAGACACAGCCTCAGCGACGTCAAGATTCGT
CACGTTGTCCTCATCAAGCTCGAGAGTACCCGCAAGGACGTTTTCCCCATTAAGAAGGGAGGCTACATCTGGGAG
ACACTCGCGGCCAGCCATGACAACAACACACTGCCCAGCAGTGCCGTCGACCTCTTCTCCAAGCTTACGCCCAAC
GCAAACTATCTGACAGGGGACTTCGACGACGGCTTCGCTCACGCCAAAACGAAGCCGCGCGGTGGCATCAACGCC
AACAACGTCCACACCACCAGCACCTACACACTCAAGAGCTTAGCCGGCACCCTCTGTGGTCTGTATCCGCTCGTG
GCCGACTTCAACCGTGAGTACGAGACGCACGTGTACCAGCCGTGTCTATCGCACATCTTCAACGCCTTCAACGCG
CTGGAGAAGGACCAAGACGATGGCGGCTCGAGCGACGACTTTAGCTCGTTCAAGTGGAGGTCGACGTTTATGCAG
TCCGTCACCGACGGCTACGACAAGCAGAACGCCGAGATGCCCGTCTTAGGCTACCCCGAGGGCTTCTTCCTCAGC
AAGGAGATTCTACAGAGCGGCGAGGGCAAGTTTGGCAAGATTAACGTGTCCGACATCAACTACTACGGCATGTCG
GAAGAGGTGCTCAAGGACTACGTCCGCGAGGAGTTTGCGGCGGCCAAGAAGGACAATGGACGCGTCTTCCTGTCG
CATCTGACAAGCACCACGCATCACCCGTTTGTCCTGCCTGAAGGCGAAAACTATCTACCGCTCACGGACGACAAG
AAGCTCAACGACTTGTCGCACTACGTCAACACTATTGGGTTCGCCGACCAATGGCTGGGCCAGATTCTCGAGGTC
CTGGAAGAGGAGGGCGTTGCCGACGAGACTCTTGTCGTCCTCGTCGGCGACCACGGCCTCTCGCTGCCGGAGAAT
GGGGGTGTGACGCCCTATTATAACGGCAACGTGGGCAACTTCCACGTGCCCCTGGTGCTCTCCCACCCATCGTTG
CCGGCCATCGACGTCAACGACGCGGCGGCATCCCTTTCGATCCTGCCGACGATTCTCGACCTTCTAGTTGAGACG
GGCTCTCTCTCCAAGACGACGAAACAGGCGGCGCAAGACCTGATGAAGAACTACGAGGGACAGTCGCTGCTCCGG
CCTCAGCGCCAAGCCTCATGGGAGACGGGCGAGTCCAACTGGCTCTTCACAGTGATGAACCCTGGCCGGGCAACG
GTGGCGATCCGCGACGCTCACCGACCGGACTGGCGGCTCATTATGCCCGTCATCGACGACGTCGAGTGGCGCTTC
ACCAACACGGCCGAGGATCCGCACGAGATGGAGCCCGTCATCTCCTTCTCCTTTGCCCCATTACTCGAGAAGATT
GAGCGCAAGCATGGCGTCGAGGCCGCGACGTGGGCCGAGACGGCCGCCTTCAAGGCCCAGTGGTGGGTCAAGGAA
AACAACAAGCGGTGGCGCTTCGATGCCAAATGA
Gene >Ophio5|8535
ATGATCTACCGTCTCCTCGGCCGCCCTCAGGCCGTGCCGCCTCCCCCAGGCCCGTCCTTTGCCGCCTCCGTCATC
CTCTACCTCTTCAACAGACGCGTCTTCTCCCTTTCTCGCTATGTCTTCTCCATCTTCGCCGTGGCCGTGTTCGGC
GCCAAGCTGGTGCACATCTACGCCCATGTTGATGCCATGGCCTCGGATCTCCTCGGCTACGGCATGTCCTTCTTC
GCCCAGGACGTCTTATTCCTCGTCATGATGCGCCTGCTGCTCGACAACATATCCTCACTCAACATCCGCTGCCTC
CGCATCCTGGCAATCTCTCTGAGCTCCATCCTCGTTGCCTCGACCCTCTTCTTCGCCTCCGTCAGCATATCCTTC
TTCGTCGTCACGGGCACGGAGCTCCGCTGGCGTAACGTTGGCGTGGCCAGCGATTCAGCCGCCTGGGGCATGCTG
CTCTCCGGGCTCTTCTCCTGCAGTGTCGTCGGCGCTTCCATCCTTCTCGTTGCCTGGCTGGCGCAGGACCTGGTT
GCCAACGTCTTCGGCGCCATCCTCAACCTTGTCAGATGGCCCTTCTCCCTGGCTCTGAGCAAGATTGCGCCCCGA
GCTCCGTCTCTTCCCCTGGCATATCAGCACATCCCGCAGGACGACGTTGAGGATGCTTCCGGCGAACGCAAGCTT
CTGGCAGTCGACGATGCTCAACAGGTCCCTGTTTCTGCCGATGACGAGTCTCAGAAACGGCCGTCCCTGTGCCTG
CATGTTAGTCTCGCCATCACTCTCATCATCATTGCCATCTCGACCATTGCCCGCCCCGTTGATAGCTCCCTGATC
TTCATGTCGTGGACGCTGCCCCTGGTGCCCTTCATCGACCTGCTGCCTTCGTCGCCCAGCGTCGCCGGCCTGGTC
CCTTCGTATGGCAACGACGTCAATAGCGACTTGGAGAACCGGACGGCGCTCGCGGAACCCCCGTCTTGGACCTGG
CTGCCCGAGGGCGAGACGCTTCCGGGCTTCGAGGACTGGTACGAGGGCAAGGACCACTATCGCGCGGACAAGGAC
CCCCTTCGCGTCTCCAACCTCAACTCGGCCTTGCTGCCGGAGCTCAGACACAGCCTCAGCGACGTCAAGATTCGT
CACGTTGTCCTCATCAAGCTCGAGAGTACCCGCAAGGACGTTTTCCCCATTAAGAAGGGAGGCTACATCTGGGAG
ACACTCGCGGCCAGCCATGACAACAACACACTGCCCAGCAGTGCCGTCGACCTCTTCTCCAAGCTTACGCCCAAC
GCAAACTATCTGACAGGGGACTTCGACGACGGCTTCGCTCACGCCAAAACGAAGCCGCGCGGTGGCATCAACGCC
AACAACGTCCACACCACCAGCACCTACACACTCAAGAGCTTAGCCGGCACCCTCTGTGGTCTGTATCCGCTCGTG
GCCGACTTCAACCGTGAGTACGAGACGCACGTGTACCAGCCGTGTCTATCGCACATCTTCAACGCCTTCAACGCG
CTGGAGAAGGACCAAGACGATGGCGGCTCGAGCGACGACTTTAGCTCGTTCAAGTGGAGGTCGACGTTTATGCAG
TCCGTCACCGACGGCTACGACAAGCAGAACGCCGAGATGCCCGTCTTAGGCTACCCCGAGGGCTTCTTCCTCAGC
AAGGAGATTCTACAGAGCGGCGAGGGCAAGTTTGGCAAGATTAACGTGTCCGACATCAACTACTACGGCATGTCG
GAAGAGGTGCTCAAGGACTACGTCCGCGAGGAGTTTGCGGCGGCCAAGAAGGACAATGGACGCGTCTTCCTGTCG
CATCTGACAAGCACCACGCATCACCCGTTTGTCCTGCCTGAAGGCGAAAACTATCTACCGCTCACGGACGACAAG
AAGCTCAACGACTTGTCGCACTACGTCAACACTATTGGGTTCGCCGACCAATGGCTGGGCCAGATTCTCGAGGTC
CTGGAAGAGGAGGGCGTTGCCGACGAGACTCTTGTCGTCCTCGTCGGCGACCACGGCCTCTCGCTGCCGGAGAAT
GGGGGTGTGACGCCCTATTATAACGGCAACGTGGGCAACTTCCACGTGCCCCTGGTGCTCTCCCACCCATCGTTG
CCGGCCATCGACGTCAACGACGCGGCGGCATCCCTTTCGATCCTGCCGACGATTCTCGACCTTCTAGTTGAGACG
GGCTCTCTCTCCAAGACGACGAAACAGGCGGCGCAAGACCTGATGAAGAACTACGAGGGACAGTCGCTGCTCCGG
CCTCAGCGCCAAGCCTCATGGGAGACGGGCGAGTCCAACTGGCTCTTCACAGTGATGAACCCTGGCCGGGCAACG
GTGGCGATCCGCGACGCTCACCGACCGGACTGGCGGCTCATTATGCCCGTCATCGACGACGTCGAGTGGCGCTTC
ACCAACACGGCCGAGGATCCGCACGAGATGGAGCCCGTCATCTCCTTCTCCTTTGCCCCATTACTCGAGAAGATT
GAGCGCAAGCATGGCGTCGAGGCCGCGACGTGGGCCGAGACGGCCGCCTTCAAGGCCCAGTGGTGGGTCAAGGAA
AACAACAAGCGGTGGCGCTTCGATGCCAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail