Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8527
Gene name
Locationscaffold_965:2345..4403
Strand+
Gene length (bp)2058
Transcript length (bp)1800
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.8E-39 134 545

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 125 542 2.0E-34
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 125 547 8.0E-33
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 99 544 8.0E-33
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 125 542 2.0E-32
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 125 542 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 125 542 2.0E-34
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 125 547 8.0E-33
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 99 544 8.0E-33
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 125 542 2.0E-32
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 125 542 2.0E-32
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 125 546 3.0E-30
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 103 539 6.0E-24
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 125 542 1.0E-22
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 360 546 6.0E-20
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 108 541 7.0E-20
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 226 546 1.0E-19
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 125 540 3.0E-19
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 185 542 1.0E-18
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 361 542 1.0E-17
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 183 542 2.0E-17
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 317 536 3.0E-16
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 183 542 9.0E-16
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 183 541 1.0E-15
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 175 541 2.0E-15
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 183 542 2.0E-15
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 134 542 3.0E-15
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 183 542 3.0E-15
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 125 541 6.0E-15
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 175 541 7.0E-15
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 302 532 1.0E-14
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 319 529 2.0E-14
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 215 541 2.0E-14
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 183 542 2.0E-14
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 183 542 3.0E-14
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 357 540 3.0E-14
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 179 545 4.0E-14
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 228 556 4.0E-14
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 318 569 4.0E-14
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 227 554 4.0E-14
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 318 545 5.0E-14
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 226 536 5.0E-14
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 285 569 6.0E-14
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 359 542 7.0E-14
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 183 541 1.0E-13
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 314 540 1.0E-13
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 183 569 1.0E-13
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 104 548 1.0E-13
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 330 542 1.0E-13
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 302 534 2.0E-13
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 288 540 2.0E-13
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 224 540 2.0E-13
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 171 536 2.0E-13
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 227 541 2.0E-13
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 286 541 3.0E-13
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 361 542 3.0E-13
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 324 542 6.0E-13
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 288 538 6.0E-13
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 337 546 7.0E-13
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 288 538 7.0E-13
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 306 532 8.0E-13
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 183 542 8.0E-13
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 302 582 8.0E-13
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 183 542 1.0E-12
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 228 541 1.0E-12
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 306 532 1.0E-12
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 228 541 1.0E-12
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 183 542 1.0E-12
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 183 569 2.0E-12
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 183 542 2.0E-12
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 368 541 2.0E-12
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 368 541 3.0E-12
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 183 541 3.0E-12
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 323 546 5.0E-12
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 183 542 6.0E-12
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 227 542 7.0E-12
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 183 545 8.0E-12
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 183 542 8.0E-12
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 320 542 8.0E-12
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 285 569 8.0E-12
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 324 541 8.0E-12
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 342 541 8.0E-12
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 311 550 8.0E-12
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 319 542 8.0E-12
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 361 542 9.0E-12
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 183 542 9.0E-12
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 324 541 9.0E-12
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 183 539 1.0E-11
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 311 538 1.0E-11
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 183 542 1.0E-11
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 305 551 2.0E-11
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 227 550 2.0E-11
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 283 540 2.0E-11
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 185 548 2.0E-11
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 359 539 2.0E-11
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 368 541 2.0E-11
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 330 542 3.0E-11
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 257 533 3.0E-11
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 342 542 3.0E-11
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 183 542 3.0E-11
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 226 541 3.0E-11
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 355 541 4.0E-11
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 368 545 4.0E-11
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 286 541 4.0E-11
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 307 541 5.0E-11
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 311 541 5.0E-11
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 316 554 5.0E-11
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 330 542 5.0E-11
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 183 541 5.0E-11
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 364 541 6.0E-11
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 183 541 6.0E-11
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 345 539 6.0E-11
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 305 540 7.0E-11
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 333 541 8.0E-11
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 359 549 9.0E-11
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 346 571 9.0E-11
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 326 533 1.0E-10
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 307 541 1.0E-10
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 368 541 2.0E-10
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 177 544 2.0E-10
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 348 569 3.0E-10
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 330 542 3.0E-10
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 348 569 3.0E-10
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 361 545 4.0E-10
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 236 541 4.0E-10
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 330 540 4.0E-10
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 148 539 4.0E-10
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 180 549 4.0E-10
sp|Q9FLC8|C79A2_ARATH Phenylalanine N-monooxygenase OS=Arabidopsis thaliana GN=CYP79A2 PE=1 SV=1 226 537 5.0E-10
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 217 544 5.0E-10
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 183 542 5.0E-10
sp|Q12585|CP52T_CANMA Cytochrome P450 52D1 OS=Candida maltosa GN=CYP52D1 PE=2 SV=1 357 534 6.0E-10
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 181 536 8.0E-10
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 184 541 9.0E-10
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 355 541 1.0E-09
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 368 541 1.0E-09
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 138 549 1.0E-09
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 318 541 1.0E-09
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 360 541 1.0E-09
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 360 538 1.0E-09
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 184 554 1.0E-09
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 227 532 1.0E-09
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 355 541 2.0E-09
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 183 541 3.0E-09
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 214 540 3.0E-09
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 185 542 3.0E-09
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 314 540 3.0E-09
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 307 541 4.0E-09
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 355 549 4.0E-09
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 355 541 4.0E-09
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 238 527 4.0E-09
sp|P30612|CP52P_CANTR Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 357 539 4.0E-09
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 307 541 5.0E-09
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 337 542 5.0E-09
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 214 546 6.0E-09
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 273 541 6.0E-09
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 326 546 6.0E-09
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 359 556 6.0E-09
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 283 539 7.0E-09
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 274 548 8.0E-09
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 282 551 9.0E-09
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 171 543 1.0E-08
sp|Q9C788|C70B1_ARATH Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 358 533 1.0E-08
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 312 541 1.0E-08
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 307 541 1.0E-08
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 238 527 1.0E-08
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 334 547 1.0E-08
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 248 540 1.0E-08
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 310 540 2.0E-08
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 138 541 2.0E-08
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 312 541 2.0E-08
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 218 549 2.0E-08
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 330 542 2.0E-08
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 360 541 2.0E-08
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 355 542 2.0E-08
sp|O65787|C71B6_ARATH Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 329 540 2.0E-08
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 238 541 2.0E-08
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 212 540 2.0E-08
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 422 541 3.0E-08
sp|Q501D8|C79B3_ARATH Tryptophan N-monooxygenase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1 244 537 3.0E-08
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 310 540 3.0E-08
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 180 539 3.0E-08
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 359 540 4.0E-08
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 235 540 4.0E-08
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 355 549 4.0E-08
sp|O81345|C79B1_SINAL Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE=2 SV=1 207 537 4.0E-08
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 185 542 4.0E-08
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 368 541 4.0E-08
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 227 548 4.0E-08
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 312 542 5.0E-08
sp|O81346|C79B2_ARATH Tryptophan N-monooxygenase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2 210 537 5.0E-08
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 354 548 5.0E-08
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 226 541 5.0E-08
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 230 554 6.0E-08
sp|Q54KV0|C513B_DICDI Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 359 540 6.0E-08
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 180 556 6.0E-08
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 364 545 8.0E-08
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 306 549 9.0E-08
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 324 542 1.0E-07
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 177 533 1.0E-07
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 228 540 1.0E-07
sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 359 540 1.0E-07
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 361 534 1.0E-07
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 180 548 1.0E-07
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 214 540 2.0E-07
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 359 538 2.0E-07
sp|Q9FUY7|C79F2_ARATH Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 317 537 2.0E-07
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 216 540 2.0E-07
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 312 547 2.0E-07
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 180 549 3.0E-07
sp|Q12587|CP52Q_CANMA Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 361 532 3.0E-07
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 215 542 3.0E-07
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 283 549 4.0E-07
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 219 555 5.0E-07
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 359 542 6.0E-07
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 334 536 6.0E-07
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 323 540 1.0E-06
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 224 557 2.0E-06
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 358 540 3.0E-06
sp|P93703|C71C3_MAIZE Cytochrome P450 71C3 OS=Zea mays GN=CYP71C3 PE=2 SV=1 224 540 5.0E-06
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 329 542 5.0E-06
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 422 548 6.0E-06
sp|Q9FH66|C71AG_ARATH Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 233 556 6.0E-06
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 422 537 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8527
MDGPSWRLRVGAWIAPERAADVPASPPLFLRPLVGQFPPQKKLYYAAHDAEFVIAKPELAPVARRFPFVGANSGR
QRAVVKGKESTADKADVVDGMGPVQPVFPPPGPCSGTVLGSSDGHTVVLYGDRIRPEPNTVLFCGPDAHSDIYGT
RSNVRRSCFYSAFNKTEREETTFTTVDVARHARKRRILNVCFNDKLVRAATPFVIKHVDRWNHLLMQTEDTEWSP
VVDFSQAVDALIFDIMGDLSFGRSFDIKESGDNPIKEVPDCISAALCFYYPICRSPFLKLLLWLKPRGLDRAVEL
ISPPTVHKYDDFVCGSVADRLALQRKQADKPEAERRQDMFYFLCDARDTETGLPAYNEDELRAECSVLITAGSGT
TAVSLSGVFFYLTGDRRRYQKLVDEILTTFATADDIVYGPKLLGCRYLRACVDEGMRLTPAGASEHPREVLPGGI
QIRGEYYPAGTTVGTVPWADSRNQDVYGDAHLFRPERWIVDEASGVSKEDVLRIKANFHPFLSGPCSCIGKSLAL
MEMYVTVARTLHRLDVRRRPGSTLGGGAPELGWGERDPTQLQLRDAFVSLRQGPEVQFRKRSFTSTCTQQTGAV
Coding >Ophio5|8527
ATGGACGGGCCCAGTTGGCGTCTTCGAGTTGGCGCTTGGATAGCTCCTGAGCGTGCTGCTGATGTTCCCGCCTCT
CCTCCCCTCTTTCTCCGTCCACTCGTCGGCCAGTTTCCACCACAGAAGAAGCTGTACTACGCTGCCCACGATGCT
GAGTTTGTCATTGCAAAGCCTGAGCTGGCTCCAGTGGCTCGCCGTTTCCCTTTTGTCGGTGCCAATTCTGGTAGG
CAACGGGCCGTCGTCAAGGGGAAAGAGTCGACAGCTGACAAGGCAGATGTAGTTGACGGCATGGGCCCTGTACAA
CCTGTATTTCCACCCCCTGGCCCATGTTCCGGGACCGTTTTGGGGTCGAGCGACGGGCATACCGTCGTGTTGTAC
GGCGATAGGATCCGTCCGGAACCCAATACCGTTCTCTTCTGCGGCCCGGACGCTCACTCGGACATTTACGGCACG
AGATCCAATGTGCGCCGGAGCTGTTTCTACAGCGCCTTTAATAAGACGGAGCGGGAGGAGACGACGTTTACGACG
GTCGACGTGGCCAGGCACGCTCGGAAGCGAAGGATTCTCAACGTATGCTTCAACGATAAACTGGTCCGCGCCGCA
ACGCCTTTTGTTATCAAGCATGTCGATCGCTGGAATCATCTCCTCATGCAGACGGAAGACACGGAGTGGTCTCCC
GTCGTCGACTTCTCACAAGCCGTCGACGCTCTCATCTTCGACATCATGGGAGACCTCAGCTTCGGACGGTCGTTT
GACATCAAGGAGTCGGGAGACAACCCGATCAAGGAGGTGCCGGACTGCATCTCCGCCGCTCTGTGTTTCTACTAT
CCGATATGTCGATCTCCTTTCTTGAAGCTCTTGCTCTGGCTTAAGCCTCGCGGCCTTGACCGGGCCGTCGAGCTC
ATCTCGCCGCCGACGGTGCACAAGTACGATGATTTTGTCTGTGGCAGCGTGGCGGATCGATTGGCGCTGCAGAGA
AAGCAGGCGGACAAGCCCGAGGCCGAGAGGCGTCAGGACATGTTCTATTTCTTGTGCGACGCCCGGGATACCGAA
ACCGGTCTCCCGGCCTATAACGAAGACGAGCTACGGGCCGAATGCAGCGTGCTCATCACGGCCGGGTCCGGCACG
ACGGCCGTCAGCCTCTCCGGCGTCTTCTTCTACCTCACCGGAGACCGGAGACGATACCAGAAGCTGGTGGACGAG
ATCCTGACGACGTTCGCCACGGCCGACGACATCGTCTACGGACCCAAACTGCTCGGCTGTCGCTATCTACGAGCC
TGCGTCGACGAAGGCATGCGTCTCACTCCGGCCGGAGCGAGCGAACATCCGCGAGAGGTGCTACCTGGCGGGATA
CAGATCAGGGGAGAGTACTATCCGGCCGGCACCACCGTCGGCACCGTGCCCTGGGCCGACTCTCGGAACCAAGAC
GTCTACGGTGACGCTCACCTCTTCCGACCGGAGCGTTGGATCGTCGACGAGGCCAGCGGCGTAAGCAAGGAAGAC
GTTTTGCGCATCAAGGCCAACTTCCATCCCTTCCTCAGCGGACCCTGTAGCTGCATCGGTAAGAGTCTGGCCTTG
ATGGAGATGTACGTGACGGTGGCGAGGACGCTTCATCGACTGGATGTCAGGAGAAGGCCTGGATCTACGCTCGGT
GGAGGGGCGCCCGAGCTTGGATGGGGAGAAAGGGATCCGACTCAGCTGCAGCTGAGGGACGCTTTTGTTTCCCTC
CGGCAGGGTCCAGAGGTTCAGTTTAGGAAGCGGTCGTTTACATCTACCTGTACACAACAGACGGGTGCTGTA
Transcript >Ophio5|8527
ATGGACGGGCCCAGTTGGCGTCTTCGAGTTGGCGCTTGGATAGCTCCTGAGCGTGCTGCTGATGTTCCCGCCTCT
CCTCCCCTCTTTCTCCGTCCACTCGTCGGCCAGTTTCCACCACAGAAGAAGCTGTACTACGCTGCCCACGATGCT
GAGTTTGTCATTGCAAAGCCTGAGCTGGCTCCAGTGGCTCGCCGTTTCCCTTTTGTCGGTGCCAATTCTGGTAGG
CAACGGGCCGTCGTCAAGGGGAAAGAGTCGACAGCTGACAAGGCAGATGTAGTTGACGGCATGGGCCCTGTACAA
CCTGTATTTCCACCCCCTGGCCCATGTTCCGGGACCGTTTTGGGGTCGAGCGACGGGCATACCGTCGTGTTGTAC
GGCGATAGGATCCGTCCGGAACCCAATACCGTTCTCTTCTGCGGCCCGGACGCTCACTCGGACATTTACGGCACG
AGATCCAATGTGCGCCGGAGCTGTTTCTACAGCGCCTTTAATAAGACGGAGCGGGAGGAGACGACGTTTACGACG
GTCGACGTGGCCAGGCACGCTCGGAAGCGAAGGATTCTCAACGTATGCTTCAACGATAAACTGGTCCGCGCCGCA
ACGCCTTTTGTTATCAAGCATGTCGATCGCTGGAATCATCTCCTCATGCAGACGGAAGACACGGAGTGGTCTCCC
GTCGTCGACTTCTCACAAGCCGTCGACGCTCTCATCTTCGACATCATGGGAGACCTCAGCTTCGGACGGTCGTTT
GACATCAAGGAGTCGGGAGACAACCCGATCAAGGAGGTGCCGGACTGCATCTCCGCCGCTCTGTGTTTCTACTAT
CCGATATGTCGATCTCCTTTCTTGAAGCTCTTGCTCTGGCTTAAGCCTCGCGGCCTTGACCGGGCCGTCGAGCTC
ATCTCGCCGCCGACGGTGCACAAGTACGATGATTTTGTCTGTGGCAGCGTGGCGGATCGATTGGCGCTGCAGAGA
AAGCAGGCGGACAAGCCCGAGGCCGAGAGGCGTCAGGACATGTTCTATTTCTTGTGCGACGCCCGGGATACCGAA
ACCGGTCTCCCGGCCTATAACGAAGACGAGCTACGGGCCGAATGCAGCGTGCTCATCACGGCCGGGTCCGGCACG
ACGGCCGTCAGCCTCTCCGGCGTCTTCTTCTACCTCACCGGAGACCGGAGACGATACCAGAAGCTGGTGGACGAG
ATCCTGACGACGTTCGCCACGGCCGACGACATCGTCTACGGACCCAAACTGCTCGGCTGTCGCTATCTACGAGCC
TGCGTCGACGAAGGCATGCGTCTCACTCCGGCCGGAGCGAGCGAACATCCGCGAGAGGTGCTACCTGGCGGGATA
CAGATCAGGGGAGAGTACTATCCGGCCGGCACCACCGTCGGCACCGTGCCCTGGGCCGACTCTCGGAACCAAGAC
GTCTACGGTGACGCTCACCTCTTCCGACCGGAGCGTTGGATCGTCGACGAGGCCAGCGGCGTAAGCAAGGAAGAC
GTTTTGCGCATCAAGGCCAACTTCCATCCCTTCCTCAGCGGACCCTGTAGCTGCATCGGTAAGAGTCTGGCCTTG
ATGGAGATGTACGTGACGGTGGCGAGGACGCTTCATCGACTGGATGTCAGGAGAAGGCCTGGATCTACGCTCGGT
GGAGGGGCGCCCGAGCTTGGATGGGGAGAAAGGGATCCGACTCAGCTGCAGCTGAGGGACGCTTTTGTTTCCCTC
CGGCAGGGTCCAGAGGTTCAGTTTAGGAAGCGGTCGTTTACATCTACCTGTACACAACAGACGGGTGCTGTATAG
Gene >Ophio5|8527
ATGGACGGGCCCAGTTGGCGTCTTCGAGTTGGCGCTTGGATAGCTCCTGAGCGTGCTGCTGATGTTGTTGGTTGG
GCGGCCCAACGATGCAACAGCGGCGGCGTTGACGACTAACGCGTTCATAGAAAACAACATGTTGTCTTGAAGTTG
GTCCTCGTGCGATCCCTCCAACTTGATTACCGTGACTAACTGGGCCTATGCACATTTAGCCCGCCTCTCCTCCCC
TCTTTCTCCGTCCACTCGTCGGCCAGTTTCCACCACAGAAGAAGCTGTACTACGCTGCCCACGATGCTGAGTTTG
TCATTGCAAAGCCTGAGCTGGCTCCAGTGGCTCGCCGTTTCCCTTTTGTCGGTGCCAATTCTGGTAGGCAACGGG
CCGTCGTCAAGGGGAAAGAGTCGACAGCTGACAAGGCAGATGTAGTTGACGGCATGGGCCCTGTACAACCTGTAT
TTCCACCCCCTGGCCCATGTTCCGGGACCGTTTTGGGGTCGAGCGACGGGCATACCGTCGTGGTATTATACGATT
CAAGGGAAGCGTCATATCTGGCTGTGGCAGCAGTTTCAGTTGTACGGCGATAGGATCCGTCCGGAACCCAATACC
GTTCTCTTCTGCGGCCCGGACGCTCACTCGGACATTTACGGCACGAGATCCAATGTGCGCCGGAGCTGTTTCTAC
AGCGCCTTTAATAAGACGGAGCGGGAGGAGACGACGTTTACGACGGTCGACGTGGCCAGGCACGCTCGGAAGCGA
AGGATTCTCAACGTATGCTTCAACGATAAACTGGTCCGCGCCGCAACGCCTTTTGTTATCAAGCATGTCGATCGC
TGGAATCATCTCCTCATGCAGACGGAAGACACGGAGTGGTCTCCCGTCGTCGACTTCTCACAAGCCGTCGACGCT
CTCATCTTCGACATCATGGGAGACCTCAGCTTCGGACGGTCGTTTGACATCAAGGAGTCGGGAGACAACCCGATC
AAGGAGGTGCCGGACTGCATCTCCGCCGCTCTGTGTTTCTACTATCCGGTGAGATTGAGAATTGCAGACCGCTGC
AGCTCCTCTGCTGTTGCTGATGCGTAGACAAAAAAGATATGTCGATCTCCTTTCTTGAAGCTCTTGCTCTGGCTT
AAGCCTCGCGGCCTTGACCGGGCCGTCGAGCTCATCTCGCCGCCGACGGTGCACAAGTACGATGATTTTGTCTGT
GGCAGCGTGGCGGATCGATTGGCGCTGCAGAGAAAGCAGGCGGACAAGCCCGAGGCCGAGAGGCGTCAGGACATG
TTCTATTTCTTGTGCGACGCCCGGGATACCGAAACCGGTCTCCCGGCCTATAACGAAGACGAGCTACGGGCCGAA
TGCAGCGTGCTCATCACGGCCGGGTCCGGCACGACGGCCGTCAGCCTCTCCGGCGTCTTCTTCTACCTCACCGGA
GACCGGAGACGATACCAGAAGCTGGTGGACGAGATCCTGACGACGTTCGCCACGGCCGACGACATCGTCTACGGA
CCCAAACTGCTCGGCTGTCGCTATCTACGAGCCTGCGTCGACGAAGGCATGCGTCTCACTCCGGCCGGAGCGAGC
GAACATCCGCGAGAGGTGCTACCTGGCGGGATACAGATCAGGGGAGAGTACTATCCGGCCGGCACCACCGTCGGC
ACCGTGCCCTGGGCCGACTCTCGGAACCAAGACGTCTACGGTGACGCTCACCTCTTCCGACCGGAGCGTTGGATC
GTCGACGAGGCCAGCGGCGTAAGCAAGGAAGACGTTTTGCGCATCAAGGCCAACTTCCATCCCTTCCTCAGCGGA
CCCTGTAGCTGCATCGGTAAGAGTCTGGCCTTGATGGAGATGTACGTGACGGTGGCGAGGACGCTTCATCGACTG
GATGTCAGGAGAAGGCCTGGATCTACGCTCGGTGGAGGGGCGCCCGAGCTTGGATGGGGAGAAAGGGATCCGACT
CAGCTGCAGCTGAGGGACGCTTTTGTTTCCCTCCGGCAGGGTCCAGAGGTTCAGTTTAGGAAGCGGTCGTTTACA
TCTACCTGTACACAACAGACGGGTGCTGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail