Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8524
Gene name
Locationscaffold_963:2524..3563
Strand-
Gene length (bp)1039
Transcript length (bp)951
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04031 Las1 Las1-like 1.5E-56 8 160

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42936|LAS1_SCHPO Pre-rRNA-processing protein las1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=las1 PE=1 SV=1 9 171 2.0E-23
sp|P36146|LAS1_YEAST Protein LAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAS1 PE=1 SV=1 9 158 5.0E-22
sp|A2BE28|LAS1L_MOUSE Ribosomal biogenesis protein LAS1L OS=Mus musculus GN=Las1l PE=1 SV=1 3 170 4.0E-08
sp|Q9Y4W2|LAS1L_HUMAN Ribosomal biogenesis protein LAS1L OS=Homo sapiens GN=LAS1L PE=1 SV=2 5 158 7.0E-06

GO

GO Term Description Terminal node
GO:0090730 Las1 complex Yes
GO:0006364 rRNA processing Yes
GO:0004519 endonuclease activity Yes
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1902494 catalytic complex No
GO:0046483 heterocycle metabolic process No
GO:1905354 exoribonuclease complex No
GO:0004518 nuclease activity No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:1902555 endoribonuclease complex No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1990234 transferase complex No
GO:0034470 ncRNA processing No
GO:0061695 transferase complex, transferring phosphorus-containing groups No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0016787 hydrolase activity No
GO:0005575 cellular_component No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:0016072 rRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0003824 catalytic activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1902911 protein kinase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8524
MVRYVFNSWRRRRELLRVRRQFYHDDSDSRETRRLSRQQAVGRVSMWMTRQHCPHIVESTALLTAALLSDDVDSV
AAWSAYAVRATYAAAFSRFVTGLLDGHQDKQRKQSMYVVAATIGLPATFVELRHQSTHEQLPSRAKLRAMAERAL
VWMWNYYWRHLKEEEEDDDDDESRRAVLAYLNAPDNGDDDDDDDDARRVATLDLLRRWDTDRVVATISRLQDSLP
GNQAFLKCLSLKRDLMRVVGPDVRVRAEAELRSGADRESDIGPDADSRSEGVADDQVSHEAHSALDAEDSDADGG
WSLLVGPWRAKPIGVV
Coding >Ophio5|8524
ATGGTACGCTACGTCTTCAACAGTTGGCGGCGCCGGCGCGAGCTGCTGCGGGTTCGGCGGCAATTCTACCACGAC
GACTCCGATAGTCGTGAGACACGACGTCTTAGTCGGCAGCAGGCCGTCGGACGCGTCTCCATGTGGATGACGCGA
CAGCACTGCCCGCACATAGTGGAGTCGACGGCCCTGCTCACGGCGGCGTTGTTGAGTGACGACGTCGACTCGGTG
GCTGCTTGGTCCGCCTACGCTGTCCGAGCTACCTATGCCGCTGCTTTTAGCAGGTTCGTCACGGGCTTGCTTGAT
GGTCATCAGGATAAGCAGCGAAAGCAGAGCATGTATGTCGTGGCCGCGACAATCGGCCTACCTGCTACCTTTGTC
GAGCTTCGCCATCAGTCTACGCATGAGCAGTTGCCATCACGGGCTAAGCTGCGCGCCATGGCGGAACGGGCCCTG
GTCTGGATGTGGAATTACTACTGGAGACACTTAAAAGAGGAGGAGGAGGACGACGACGACGACGAGTCACGCCGC
GCCGTCCTGGCTTATCTCAACGCCCCGGACAACGGGGATGACGACGACGACGATGACGATGCACGACGCGTTGCT
ACGCTGGACCTCCTACGCCGCTGGGACACGGACCGGGTAGTGGCAACCATTTCCCGGCTGCAGGATTCGCTGCCC
GGGAACCAGGCTTTTCTCAAGTGCCTCAGCCTGAAGCGGGACCTCATGCGTGTCGTTGGACCGGATGTCAGGGTC
CGAGCGGAGGCTGAGCTGCGGTCCGGTGCGGATCGCGAGTCGGACATCGGGCCGGACGCCGACTCACGTTCGGAA
GGGGTTGCCGACGACCAAGTTAGTCATGAGGCGCATAGTGCGCTCGATGCGGAGGACTCTGACGCCGATGGTGGC
TGGTCGTTGCTCGTCGGGCCGTGGAGGGCTAAGCCCATTGGTGTGGTG
Transcript >Ophio5|8524
ATGGTACGCTACGTCTTCAACAGTTGGCGGCGCCGGCGCGAGCTGCTGCGGGTTCGGCGGCAATTCTACCACGAC
GACTCCGATAGTCGTGAGACACGACGTCTTAGTCGGCAGCAGGCCGTCGGACGCGTCTCCATGTGGATGACGCGA
CAGCACTGCCCGCACATAGTGGAGTCGACGGCCCTGCTCACGGCGGCGTTGTTGAGTGACGACGTCGACTCGGTG
GCTGCTTGGTCCGCCTACGCTGTCCGAGCTACCTATGCCGCTGCTTTTAGCAGGTTCGTCACGGGCTTGCTTGAT
GGTCATCAGGATAAGCAGCGAAAGCAGAGCATGTATGTCGTGGCCGCGACAATCGGCCTACCTGCTACCTTTGTC
GAGCTTCGCCATCAGTCTACGCATGAGCAGTTGCCATCACGGGCTAAGCTGCGCGCCATGGCGGAACGGGCCCTG
GTCTGGATGTGGAATTACTACTGGAGACACTTAAAAGAGGAGGAGGAGGACGACGACGACGACGAGTCACGCCGC
GCCGTCCTGGCTTATCTCAACGCCCCGGACAACGGGGATGACGACGACGACGATGACGATGCACGACGCGTTGCT
ACGCTGGACCTCCTACGCCGCTGGGACACGGACCGGGTAGTGGCAACCATTTCCCGGCTGCAGGATTCGCTGCCC
GGGAACCAGGCTTTTCTCAAGTGCCTCAGCCTGAAGCGGGACCTCATGCGTGTCGTTGGACCGGATGTCAGGGTC
CGAGCGGAGGCTGAGCTGCGGTCCGGTGCGGATCGCGAGTCGGACATCGGGCCGGACGCCGACTCACGTTCGGAA
GGGGTTGCCGACGACCAAGTTAGTCATGAGGCGCATAGTGCGCTCGATGCGGAGGACTCTGACGCCGATGGTGGC
TGGTCGTTGCTCGTCGGGCCGTGGAGGGCTAAGCCCATTGGTGTGGTGTAG
Gene >Ophio5|8524
ATGGTACGCTACGTCTTCAACAGTTGGCGGCGCCGGCGCGAGCTGCTGCGGGTTCGGCGGCAATTCTACCACGAC
GACTCCGATAGTCGTGAGACACGACGTCTTAGTCGGCAGCAGGCCGTCGGACGCGTCTCCATGTGGATGACGCGA
CAGCACTGCCCGCACATAGTGGAGTCGACGGCCCTGCTCACGGCGGCGTTGTTGAGTGACGACGTCGACTCGGTG
GCTGCTTGGTCCGCCTACGCTGTCCGAGCTACCTATGCCGCTGCTTTTAGCAGGTGAGCCGCATACCGGGCGCAA
AAAGATGGGGGGGGGGGGACCTTAGCTTGAGATTTTTCTCATCATTCTTTCTGTTTTGCTGCATAGGTTCGTCAC
GGGCTTGCTTGATGGTCATCAGGATAAGCAGCGAAAGCAGAGCATGTATGTCGTGGCCGCGACAATCGGCCTACC
TGCTACCTTTGTCGAGCTTCGCCATCAGTCTACGCATGAGCAGTTGCCATCACGGGCTAAGCTGCGCGCCATGGC
GGAACGGGCCCTGGTCTGGATGTGGAATTACTACTGGAGACACTTAAAAGAGGAGGAGGAGGACGACGACGACGA
CGAGTCACGCCGCGCCGTCCTGGCTTATCTCAACGCCCCGGACAACGGGGATGACGACGACGACGATGACGATGC
ACGACGCGTTGCTACGCTGGACCTCCTACGCCGCTGGGACACGGACCGGGTAGTGGCAACCATTTCCCGGCTGCA
GGATTCGCTGCCCGGGAACCAGGCTTTTCTCAAGTGCCTCAGCCTGAAGCGGGACCTCATGCGTGTCGTTGGACC
GGATGTCAGGGTCCGAGCGGAGGCTGAGCTGCGGTCCGGTGCGGATCGCGAGTCGGACATCGGGCCGGACGCCGA
CTCACGTTCGGAAGGGGTTGCCGACGACCAAGTTAGTCATGAGGCGCATAGTGCGCTCGATGCGGAGGACTCTGA
CGCCGATGGTGGCTGGTCGTTGCTCGTCGGGCCGTGGAGGGCTAAGCCCATTGGTGTGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail