Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8521
Gene name
Locationscaffold_961:1703..4340
Strand-
Gene length (bp)2637
Transcript length (bp)2637
Coding sequence length (bp)2634
Protein length (aa) 878

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.1E-20 543 682
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.6E-11 728 778

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 450 829 1.0E-101
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 453 828 5.0E-94
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 448 828 6.0E-94
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 447 778 4.0E-44
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 453 784 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 450 829 1.0E-101
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 453 828 5.0E-94
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 448 828 6.0E-94
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 447 778 4.0E-44
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 453 784 1.0E-40
sp|Q9D3N8|GRTP1_MOUSE Growth hormone-regulated TBC protein 1 OS=Mus musculus GN=Grtp1 PE=1 SV=1 453 778 8.0E-40
sp|Q6GL87|GRTP1_XENTR Growth hormone-regulated TBC protein 1 OS=Xenopus tropicalis GN=grtp1 PE=2 SV=1 469 833 1.0E-39
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 453 831 2.0E-39
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 507 815 1.0E-33
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 507 815 1.0E-33
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 510 842 6.0E-33
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 510 842 1.0E-32
sp|C8VDQ4|GYP2_EMENI Putative GTPase-activating protein AN11010 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11010 PE=3 SV=1 483 840 1.0E-32
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 498 815 4.0E-32
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 508 789 1.0E-31
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 507 815 1.0E-31
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 509 791 2.0E-31
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 508 842 3.0E-31
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 508 859 6.0E-31
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 453 835 4.0E-30
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 510 835 1.0E-29
sp|Q9Z1A9|TBCD8_MOUSE TBC1 domain family member 8 OS=Mus musculus GN=Tbc1d8 PE=1 SV=2 510 783 7.0E-29
sp|A3KGB4|TBC8B_MOUSE TBC1 domain family member 8B OS=Mus musculus GN=Tbc1d8b PE=1 SV=1 483 786 2.0E-28
sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 512 792 2.0E-28
sp|Q4QQU7|GRTP1_RAT Growth hormone-regulated TBC protein 1 OS=Rattus norvegicus GN=Grtp1 PE=2 SV=1 520 788 4.0E-28
sp|O95759|TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens GN=TBC1D8 PE=2 SV=3 510 783 9.0E-28
sp|Q0IIM8|TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens GN=TBC1D8B PE=1 SV=2 483 786 3.0E-27
sp|B0R0W9|TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio GN=tbc1d8b PE=3 SV=1 510 791 4.0E-27
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 474 828 2.0E-26
sp|Q9UPU7|TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2 486 815 5.0E-26
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 510 835 1.0E-25
sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda melanoleuca GN=TBC1D2 PE=3 SV=1 507 815 7.0E-25
sp|Q09445|GRTP6_CAEEL Growth hormone-regulated TBC protein 6 OS=Caenorhabditis elegans GN=tbc-6 PE=3 SV=3 453 794 1.0E-24
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 513 840 1.0E-24
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 512 815 5.0E-24
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 453 795 5.0E-24
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 512 815 8.0E-24
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 483 830 1.0E-23
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 483 805 1.0E-22
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 483 805 1.0E-22
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 482 863 7.0E-22
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 483 805 9.0E-22
sp|O94711|GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp2 PE=3 SV=1 485 783 4.0E-20
sp|Q28C33|TBC30_XENTR TBC1 domain family member 30 OS=Xenopus tropicalis GN=tbc1d30 PE=2 SV=1 518 809 1.0E-18
sp|Q69ZT9|TBC30_MOUSE TBC1 domain family member 30 OS=Mus musculus GN=Tbc1d30 PE=1 SV=2 518 804 2.0E-18
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 453 782 2.0E-18
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 482 830 4.0E-18
sp|Q9Y2I9|TBC30_HUMAN TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2 518 807 4.0E-18
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 510 782 4.0E-18
sp|Q5ZJ17|RBG1L_CHICK Rab GTPase-activating protein 1-like OS=Gallus gallus GN=RABGAP1L PE=2 SV=1 507 778 1.0E-12
sp|A0A087X179|TBC3E_HUMAN TBC1 domain family member 3E OS=Homo sapiens GN=TBC1D3E PE=2 SV=1 517 782 4.0E-12
sp|A0A087X1G2|TBC3K_HUMAN TBC1 domain family member 3K OS=Homo sapiens GN=TBC1D3K PE=3 SV=1 517 782 6.0E-12
sp|A0A087WXS9|TBC3I_HUMAN TBC1 domain family member 3I OS=Homo sapiens GN=TBC1D3I PE=3 SV=1 517 782 7.0E-12
sp|Q6IPX1|TBC3C_HUMAN TBC1 domain family member 3C OS=Homo sapiens GN=TBC1D3C PE=2 SV=3 517 782 8.0E-12
sp|Q8IZP1|TBC3A_HUMAN TBC1 domain family member 3 OS=Homo sapiens GN=TBC1D3 PE=1 SV=6 517 782 8.0E-12
sp|B9A6J9|TBC3L_HUMAN TBC1 domain family member 3L OS=Homo sapiens GN=TBC1D3L PE=2 SV=1 517 782 8.0E-12
sp|A0A087WVF3|TBC3D_HUMAN TBC1 domain family member 3D OS=Homo sapiens GN=TBC1D3D PE=2 SV=1 517 782 8.0E-12
sp|Q5RAN1|RBGP1_PONAB Rab GTPase-activating protein 1 OS=Pongo abelii GN=RABGAP1 PE=2 SV=1 514 778 9.0E-12
sp|Q9Y3P9|RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens GN=RABGAP1 PE=1 SV=3 514 778 9.0E-12
sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus musculus GN=Rabgap1 PE=1 SV=1 514 778 1.0E-11
sp|A6NER0|TBC3F_HUMAN TBC1 domain family member 3F OS=Homo sapiens GN=TBC1D3F PE=2 SV=3 517 782 1.0E-11
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 514 778 2.0E-11
sp|P0C7X1|TBC3H_HUMAN TBC1 domain family member 3H OS=Homo sapiens GN=TBC1D3H PE=2 SV=3 517 782 2.0E-11
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 514 778 2.0E-11
sp|Q6DHY5|TBC3G_HUMAN TBC1 domain family member 3G OS=Homo sapiens GN=TBC1D3G PE=2 SV=2 517 782 3.0E-11
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 515 782 2.0E-10
sp|A6NDS4|TBC3B_HUMAN TBC1 domain family member 3B OS=Homo sapiens GN=TBC1D3B PE=2 SV=2 517 782 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 31.96 17.42 46.50
CcL In ants, during behavior modification 19.61 9.73 29.49
CcD In ants, recently dead 19.54 10.22 28.86

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.030588 yes
SC16a CcD 0.023042 yes
CcL CcD 0.990657 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8521
MAVSRFDNGGSIERQRSLRNRQCSVYASRIRPNLSPIAIHTNDGAPQAIQLPPLPVSPRWDSLSNGSHLILSSPT
STDEGWSEVQVPAEASLAERRGHAAPEVLKTTTNNKEVENFSRPRKQSLRPEQCVPAPRLLATPTDLSYDLCAST
PQTPPWHSPIRPSSSKPASSPFSSPLGPPPSVDLPVPKPARARNAAGPPLTAARAPLAAPASSPMAAGGAPPPPW
MAGDGLRSSFRSQLTESSAFGTAVTERSSVLTKDSSITSLYTDEPSLEDVMCMYEKGFADDDDDDDADDDDDDED
DFDIDGDSDSNRNPSASSVVTLSAADRFDTMSFVDAPARPATAMSAPLAEGRRSDAYLAPPVPAARSALDAEIRK
SKMLFVSPAFTASVPALSGAGDLDVAEKRDSGKSLDSTPSISSSDPLPPVEVKLAPVPPSPTSLFRAAMEPEDPG
SRDRYGFKKQNQSITREQYDSWNKGYTQYLARRRKKWAAYLKECGLMTDRPIRFPPPNGKTKRFVRKGIPPDWRG
AAWFYYAGGPAILAQHSGLYEKLLEREAKSIDVEAIERDLHRTFPDNIQFQPSPCPDRPRTAPAPSSDEPPIISS
LRRVLHAFAVYNPRIGYCQSLNFLAGLLLLFVETEEQCFWLLNVITVVYLPGTHEISLEGSKVDLGVLMTELRDT
MPAVWDKIGGELEAGTRAASAPAANGKPARKPRTTLWRRDQPRLSTERLPPITLCMTAWFMSCYIGTLPMETTLR
VWDVFFYEGSKTLFRIALAIFKSGEAEIKAVSDPMEMFGVVQSLPRRMLDANGLIETCFKRRNGFGHISQDAIDE
RRQERRDKAQQDREARTTPVAGDATGGDAEEAARRKGTLFGRRRRDASRTREA
Coding >Ophio5|8521
ATGGCCGTCTCCCGCTTCGATAACGGAGGCTCGATTGAGCGACAGCGGAGCCTCCGCAATCGGCAGTGTTCCGTC
TACGCCTCACGCATCAGACCCAACCTCTCGCCCATCGCCATCCACACCAACGATGGCGCGCCACAGGCGATACAG
TTACCGCCTCTGCCAGTGTCGCCGCGTTGGGACTCGCTGTCCAACGGATCGCATCTGATTCTATCGAGCCCGACA
TCGACGGACGAGGGTTGGTCGGAAGTGCAGGTACCAGCTGAGGCCAGCCTCGCTGAGCGACGAGGCCATGCGGCG
CCCGAAGTGCTCAAGACGACGACCAACAACAAAGAGGTCGAAAACTTCTCGAGGCCGCGCAAACAGAGTCTACGG
CCGGAACAATGCGTGCCGGCTCCGCGACTGCTAGCGACGCCCACGGACCTGAGCTACGACCTCTGCGCCTCGACG
CCCCAAACGCCTCCCTGGCACAGCCCCATACGCCCGTCTTCCTCCAAACCGGCCTCGTCTCCCTTTTCCTCTCCA
CTGGGGCCTCCACCGTCGGTCGACTTGCCCGTTCCCAAGCCGGCGCGCGCCCGGAACGCCGCCGGTCCGCCCCTG
ACGGCTGCCCGGGCCCCTCTGGCTGCCCCTGCGTCTTCACCCATGGCGGCCGGTGGGGCACCGCCTCCGCCCTGG
ATGGCCGGTGACGGTCTGCGTTCGAGTTTCAGGTCGCAGCTGACTGAGTCGTCTGCGTTTGGGACGGCTGTTACG
GAGCGAAGCAGCGTTCTGACAAAGGACAGCTCCATTACGTCGCTTTATACCGACGAGCCGAGTCTGGAGGATGTC
ATGTGCATGTATGAAAAGGGTTTCGCCGACGACGACGACGACGACGACGCCGACGACGACGACGACGACGAAGAC
GATTTCGACATTGACGGCGACAGCGACAGCAACCGCAACCCGTCAGCCAGCAGTGTCGTGACTCTGTCCGCCGCT
GATCGGTTCGATACGATGAGCTTCGTCGACGCGCCGGCGCGCCCTGCCACGGCCATGTCGGCTCCTCTCGCTGAA
GGACGGCGCTCCGACGCCTACCTGGCGCCTCCCGTTCCCGCTGCCCGGTCCGCGCTCGACGCCGAGATTCGAAAA
TCCAAGATGCTCTTCGTCAGTCCCGCCTTCACCGCCTCGGTGCCTGCTCTGTCCGGCGCCGGCGACCTCGACGTG
GCCGAGAAGCGCGATTCGGGCAAGTCTCTGGACTCGACGCCGTCCATCTCCTCGTCGGATCCGCTACCTCCGGTC
GAGGTCAAGCTGGCACCGGTGCCGCCTTCGCCCACGTCGCTGTTCCGCGCCGCCATGGAGCCCGAGGATCCGGGC
TCGCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTCCATCACGAGGGAGCAGTACGACTCCTGGAACAAGGGG
TACACGCAGTACCTGGCCCGACGGCGCAAGAAGTGGGCGGCCTATCTCAAGGAGTGCGGCCTCATGACGGACCGC
CCGATCCGGTTCCCGCCGCCCAACGGCAAGACCAAACGCTTCGTTCGCAAGGGCATCCCGCCCGACTGGCGCGGC
GCCGCCTGGTTCTACTACGCCGGGGGTCCGGCCATCTTGGCCCAGCACTCGGGTCTGTACGAGAAGCTGCTGGAG
CGTGAGGCCAAGTCGATCGATGTCGAGGCCATTGAGCGCGACCTGCACCGCACCTTTCCCGACAACATCCAGTTC
CAGCCGTCGCCGTGTCCGGACCGGCCGAGGACGGCACCGGCGCCGTCGTCTGACGAGCCGCCCATCATCTCGTCG
CTGCGGCGGGTGCTGCACGCCTTCGCCGTCTATAATCCGCGCATCGGCTACTGCCAGAGCCTCAACTTTTTGGCC
GGCCTGCTGCTGCTGTTCGTCGAGACGGAGGAGCAGTGCTTCTGGCTGCTCAACGTCATCACCGTCGTCTACCTG
CCCGGCACGCACGAGATTAGCCTCGAGGGCTCCAAGGTGGACCTGGGCGTGCTGATGACGGAGCTGCGGGACACG
ATGCCGGCCGTGTGGGACAAGATTGGCGGCGAGCTCGAGGCCGGCACCCGAGCGGCTTCGGCCCCGGCGGCCAAC
GGAAAGCCGGCGCGCAAGCCGAGAACGACGCTGTGGCGGCGCGATCAGCCGCGACTGTCGACGGAGAGGCTACCT
CCCATTACTCTGTGCATGACGGCCTGGTTCATGAGCTGCTACATCGGAACGCTGCCGATGGAGACGACGCTGCGC
GTATGGGACGTCTTCTTCTACGAGGGCTCCAAGACACTCTTCCGCATCGCTCTGGCCATCTTCAAGAGCGGCGAG
GCCGAGATCAAGGCCGTGTCGGACCCGATGGAGATGTTCGGCGTGGTGCAGAGCCTGCCGCGACGAATGCTGGAC
GCCAACGGTCTGATCGAGACGTGCTTCAAGCGACGCAACGGCTTCGGCCATATCAGTCAGGACGCCATCGACGAG
CGGCGACAGGAGCGGCGTGACAAGGCGCAGCAGGACCGAGAGGCGCGGACGACGCCGGTGGCGGGCGATGCGACC
GGTGGCGATGCCGAAGAGGCCGCTCGTCGGAAGGGCACCTTGTTCGGACGGCGGCGAAGAGATGCTTCGCGGACG
CGGGAGGCG
Transcript >Ophio5|8521
ATGGCCGTCTCCCGCTTCGATAACGGAGGCTCGATTGAGCGACAGCGGAGCCTCCGCAATCGGCAGTGTTCCGTC
TACGCCTCACGCATCAGACCCAACCTCTCGCCCATCGCCATCCACACCAACGATGGCGCGCCACAGGCGATACAG
TTACCGCCTCTGCCAGTGTCGCCGCGTTGGGACTCGCTGTCCAACGGATCGCATCTGATTCTATCGAGCCCGACA
TCGACGGACGAGGGTTGGTCGGAAGTGCAGGTACCAGCTGAGGCCAGCCTCGCTGAGCGACGAGGCCATGCGGCG
CCCGAAGTGCTCAAGACGACGACCAACAACAAAGAGGTCGAAAACTTCTCGAGGCCGCGCAAACAGAGTCTACGG
CCGGAACAATGCGTGCCGGCTCCGCGACTGCTAGCGACGCCCACGGACCTGAGCTACGACCTCTGCGCCTCGACG
CCCCAAACGCCTCCCTGGCACAGCCCCATACGCCCGTCTTCCTCCAAACCGGCCTCGTCTCCCTTTTCCTCTCCA
CTGGGGCCTCCACCGTCGGTCGACTTGCCCGTTCCCAAGCCGGCGCGCGCCCGGAACGCCGCCGGTCCGCCCCTG
ACGGCTGCCCGGGCCCCTCTGGCTGCCCCTGCGTCTTCACCCATGGCGGCCGGTGGGGCACCGCCTCCGCCCTGG
ATGGCCGGTGACGGTCTGCGTTCGAGTTTCAGGTCGCAGCTGACTGAGTCGTCTGCGTTTGGGACGGCTGTTACG
GAGCGAAGCAGCGTTCTGACAAAGGACAGCTCCATTACGTCGCTTTATACCGACGAGCCGAGTCTGGAGGATGTC
ATGTGCATGTATGAAAAGGGTTTCGCCGACGACGACGACGACGACGACGCCGACGACGACGACGACGACGAAGAC
GATTTCGACATTGACGGCGACAGCGACAGCAACCGCAACCCGTCAGCCAGCAGTGTCGTGACTCTGTCCGCCGCT
GATCGGTTCGATACGATGAGCTTCGTCGACGCGCCGGCGCGCCCTGCCACGGCCATGTCGGCTCCTCTCGCTGAA
GGACGGCGCTCCGACGCCTACCTGGCGCCTCCCGTTCCCGCTGCCCGGTCCGCGCTCGACGCCGAGATTCGAAAA
TCCAAGATGCTCTTCGTCAGTCCCGCCTTCACCGCCTCGGTGCCTGCTCTGTCCGGCGCCGGCGACCTCGACGTG
GCCGAGAAGCGCGATTCGGGCAAGTCTCTGGACTCGACGCCGTCCATCTCCTCGTCGGATCCGCTACCTCCGGTC
GAGGTCAAGCTGGCACCGGTGCCGCCTTCGCCCACGTCGCTGTTCCGCGCCGCCATGGAGCCCGAGGATCCGGGC
TCGCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTCCATCACGAGGGAGCAGTACGACTCCTGGAACAAGGGG
TACACGCAGTACCTGGCCCGACGGCGCAAGAAGTGGGCGGCCTATCTCAAGGAGTGCGGCCTCATGACGGACCGC
CCGATCCGGTTCCCGCCGCCCAACGGCAAGACCAAACGCTTCGTTCGCAAGGGCATCCCGCCCGACTGGCGCGGC
GCCGCCTGGTTCTACTACGCCGGGGGTCCGGCCATCTTGGCCCAGCACTCGGGTCTGTACGAGAAGCTGCTGGAG
CGTGAGGCCAAGTCGATCGATGTCGAGGCCATTGAGCGCGACCTGCACCGCACCTTTCCCGACAACATCCAGTTC
CAGCCGTCGCCGTGTCCGGACCGGCCGAGGACGGCACCGGCGCCGTCGTCTGACGAGCCGCCCATCATCTCGTCG
CTGCGGCGGGTGCTGCACGCCTTCGCCGTCTATAATCCGCGCATCGGCTACTGCCAGAGCCTCAACTTTTTGGCC
GGCCTGCTGCTGCTGTTCGTCGAGACGGAGGAGCAGTGCTTCTGGCTGCTCAACGTCATCACCGTCGTCTACCTG
CCCGGCACGCACGAGATTAGCCTCGAGGGCTCCAAGGTGGACCTGGGCGTGCTGATGACGGAGCTGCGGGACACG
ATGCCGGCCGTGTGGGACAAGATTGGCGGCGAGCTCGAGGCCGGCACCCGAGCGGCTTCGGCCCCGGCGGCCAAC
GGAAAGCCGGCGCGCAAGCCGAGAACGACGCTGTGGCGGCGCGATCAGCCGCGACTGTCGACGGAGAGGCTACCT
CCCATTACTCTGTGCATGACGGCCTGGTTCATGAGCTGCTACATCGGAACGCTGCCGATGGAGACGACGCTGCGC
GTATGGGACGTCTTCTTCTACGAGGGCTCCAAGACACTCTTCCGCATCGCTCTGGCCATCTTCAAGAGCGGCGAG
GCCGAGATCAAGGCCGTGTCGGACCCGATGGAGATGTTCGGCGTGGTGCAGAGCCTGCCGCGACGAATGCTGGAC
GCCAACGGTCTGATCGAGACGTGCTTCAAGCGACGCAACGGCTTCGGCCATATCAGTCAGGACGCCATCGACGAG
CGGCGACAGGAGCGGCGTGACAAGGCGCAGCAGGACCGAGAGGCGCGGACGACGCCGGTGGCGGGCGATGCGACC
GGTGGCGATGCCGAAGAGGCCGCTCGTCGGAAGGGCACCTTGTTCGGACGGCGGCGAAGAGATGCTTCGCGGACG
CGGGAGGCGTAG
Gene >Ophio5|8521
ATGGCCGTCTCCCGCTTCGATAACGGAGGCTCGATTGAGCGACAGCGGAGCCTCCGCAATCGGCAGTGTTCCGTC
TACGCCTCACGCATCAGACCCAACCTCTCGCCCATCGCCATCCACACCAACGATGGCGCGCCACAGGCGATACAG
TTACCGCCTCTGCCAGTGTCGCCGCGTTGGGACTCGCTGTCCAACGGATCGCATCTGATTCTATCGAGCCCGACA
TCGACGGACGAGGGTTGGTCGGAAGTGCAGGTACCAGCTGAGGCCAGCCTCGCTGAGCGACGAGGCCATGCGGCG
CCCGAAGTGCTCAAGACGACGACCAACAACAAAGAGGTCGAAAACTTCTCGAGGCCGCGCAAACAGAGTCTACGG
CCGGAACAATGCGTGCCGGCTCCGCGACTGCTAGCGACGCCCACGGACCTGAGCTACGACCTCTGCGCCTCGACG
CCCCAAACGCCTCCCTGGCACAGCCCCATACGCCCGTCTTCCTCCAAACCGGCCTCGTCTCCCTTTTCCTCTCCA
CTGGGGCCTCCACCGTCGGTCGACTTGCCCGTTCCCAAGCCGGCGCGCGCCCGGAACGCCGCCGGTCCGCCCCTG
ACGGCTGCCCGGGCCCCTCTGGCTGCCCCTGCGTCTTCACCCATGGCGGCCGGTGGGGCACCGCCTCCGCCCTGG
ATGGCCGGTGACGGTCTGCGTTCGAGTTTCAGGTCGCAGCTGACTGAGTCGTCTGCGTTTGGGACGGCTGTTACG
GAGCGAAGCAGCGTTCTGACAAAGGACAGCTCCATTACGTCGCTTTATACCGACGAGCCGAGTCTGGAGGATGTC
ATGTGCATGTATGAAAAGGGTTTCGCCGACGACGACGACGACGACGACGCCGACGACGACGACGACGACGAAGAC
GATTTCGACATTGACGGCGACAGCGACAGCAACCGCAACCCGTCAGCCAGCAGTGTCGTGACTCTGTCCGCCGCT
GATCGGTTCGATACGATGAGCTTCGTCGACGCGCCGGCGCGCCCTGCCACGGCCATGTCGGCTCCTCTCGCTGAA
GGACGGCGCTCCGACGCCTACCTGGCGCCTCCCGTTCCCGCTGCCCGGTCCGCGCTCGACGCCGAGATTCGAAAA
TCCAAGATGCTCTTCGTCAGTCCCGCCTTCACCGCCTCGGTGCCTGCTCTGTCCGGCGCCGGCGACCTCGACGTG
GCCGAGAAGCGCGATTCGGGCAAGTCTCTGGACTCGACGCCGTCCATCTCCTCGTCGGATCCGCTACCTCCGGTC
GAGGTCAAGCTGGCACCGGTGCCGCCTTCGCCCACGTCGCTGTTCCGCGCCGCCATGGAGCCCGAGGATCCGGGC
TCGCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTCCATCACGAGGGAGCAGTACGACTCCTGGAACAAGGGG
TACACGCAGTACCTGGCCCGACGGCGCAAGAAGTGGGCGGCCTATCTCAAGGAGTGCGGCCTCATGACGGACCGC
CCGATCCGGTTCCCGCCGCCCAACGGCAAGACCAAACGCTTCGTTCGCAAGGGCATCCCGCCCGACTGGCGCGGC
GCCGCCTGGTTCTACTACGCCGGGGGTCCGGCCATCTTGGCCCAGCACTCGGGTCTGTACGAGAAGCTGCTGGAG
CGTGAGGCCAAGTCGATCGATGTCGAGGCCATTGAGCGCGACCTGCACCGCACCTTTCCCGACAACATCCAGTTC
CAGCCGTCGCCGTGTCCGGACCGGCCGAGGACGGCACCGGCGCCGTCGTCTGACGAGCCGCCCATCATCTCGTCG
CTGCGGCGGGTGCTGCACGCCTTCGCCGTCTATAATCCGCGCATCGGCTACTGCCAGAGCCTCAACTTTTTGGCC
GGCCTGCTGCTGCTGTTCGTCGAGACGGAGGAGCAGTGCTTCTGGCTGCTCAACGTCATCACCGTCGTCTACCTG
CCCGGCACGCACGAGATTAGCCTCGAGGGCTCCAAGGTGGACCTGGGCGTGCTGATGACGGAGCTGCGGGACACG
ATGCCGGCCGTGTGGGACAAGATTGGCGGCGAGCTCGAGGCCGGCACCCGAGCGGCTTCGGCCCCGGCGGCCAAC
GGAAAGCCGGCGCGCAAGCCGAGAACGACGCTGTGGCGGCGCGATCAGCCGCGACTGTCGACGGAGAGGCTACCT
CCCATTACTCTGTGCATGACGGCCTGGTTCATGAGCTGCTACATCGGAACGCTGCCGATGGAGACGACGCTGCGC
GTATGGGACGTCTTCTTCTACGAGGGCTCCAAGACACTCTTCCGCATCGCTCTGGCCATCTTCAAGAGCGGCGAG
GCCGAGATCAAGGCCGTGTCGGACCCGATGGAGATGTTCGGCGTGGTGCAGAGCCTGCCGCGACGAATGCTGGAC
GCCAACGGTCTGATCGAGACGTGCTTCAAGCGACGCAACGGCTTCGGCCATATCAGTCAGGACGCCATCGACGAG
CGGCGACAGGAGCGGCGTGACAAGGCGCAGCAGGACCGAGAGGCGCGGACGACGCCGGTGGCGGGCGATGCGACC
GGTGGCGATGCCGAAGAGGCCGCTCGTCGGAAGGGCACCTTGTTCGGACGGCGGCGAAGAGATGCTTCGCGGACG
CGGGAGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail