Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8521
Gene name
Locationscaffold_961:1703..4340
Strand-
Gene length (bp)2637
Transcript length (bp)2637
Coding sequence length (bp)2634
Protein length (aa) 878

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.1E-20 543 682
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.6E-11 728 778

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 450 829 1.0E-101
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 453 828 5.0E-94
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 448 828 6.0E-94
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 447 778 4.0E-44
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 453 784 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 450 829 1.0E-101
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 453 828 5.0E-94
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 448 828 6.0E-94
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 447 778 4.0E-44
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 453 784 1.0E-40
sp|Q9D3N8|GRTP1_MOUSE Growth hormone-regulated TBC protein 1 OS=Mus musculus GN=Grtp1 PE=1 SV=1 453 778 8.0E-40
sp|Q6GL87|GRTP1_XENTR Growth hormone-regulated TBC protein 1 OS=Xenopus tropicalis GN=grtp1 PE=2 SV=1 469 833 1.0E-39
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 453 831 2.0E-39
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 507 815 1.0E-33
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 507 815 1.0E-33
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 510 842 6.0E-33
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 510 842 1.0E-32
sp|C8VDQ4|GYP2_EMENI Putative GTPase-activating protein AN11010 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11010 PE=3 SV=1 483 840 1.0E-32
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 498 815 4.0E-32
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 508 789 1.0E-31
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 507 815 1.0E-31
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 509 791 2.0E-31
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 508 842 3.0E-31
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 508 859 6.0E-31
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 453 835 4.0E-30
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 510 835 1.0E-29
sp|Q9Z1A9|TBCD8_MOUSE TBC1 domain family member 8 OS=Mus musculus GN=Tbc1d8 PE=1 SV=2 510 783 7.0E-29
sp|A3KGB4|TBC8B_MOUSE TBC1 domain family member 8B OS=Mus musculus GN=Tbc1d8b PE=1 SV=1 483 786 2.0E-28
sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 512 792 2.0E-28
sp|Q4QQU7|GRTP1_RAT Growth hormone-regulated TBC protein 1 OS=Rattus norvegicus GN=Grtp1 PE=2 SV=1 520 788 4.0E-28
sp|O95759|TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens GN=TBC1D8 PE=2 SV=3 510 783 9.0E-28
sp|Q0IIM8|TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens GN=TBC1D8B PE=1 SV=2 483 786 3.0E-27
sp|B0R0W9|TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio GN=tbc1d8b PE=3 SV=1 510 791 4.0E-27
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 474 828 2.0E-26
sp|Q9UPU7|TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2 486 815 5.0E-26
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 510 835 1.0E-25
sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda melanoleuca GN=TBC1D2 PE=3 SV=1 507 815 7.0E-25
sp|Q09445|GRTP6_CAEEL Growth hormone-regulated TBC protein 6 OS=Caenorhabditis elegans GN=tbc-6 PE=3 SV=3 453 794 1.0E-24
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 513 840 1.0E-24
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 512 815 5.0E-24
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 453 795 5.0E-24
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 512 815 8.0E-24
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 483 830 1.0E-23
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 483 805 1.0E-22
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 483 805 1.0E-22
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 482 863 7.0E-22
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 483 805 9.0E-22
sp|O94711|GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp2 PE=3 SV=1 485 783 4.0E-20
sp|Q28C33|TBC30_XENTR TBC1 domain family member 30 OS=Xenopus tropicalis GN=tbc1d30 PE=2 SV=1 518 809 1.0E-18
sp|Q69ZT9|TBC30_MOUSE TBC1 domain family member 30 OS=Mus musculus GN=Tbc1d30 PE=1 SV=2 518 804 2.0E-18
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 453 782 2.0E-18
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 482 830 4.0E-18
sp|Q9Y2I9|TBC30_HUMAN TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2 518 807 4.0E-18
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 510 782 4.0E-18
sp|Q5ZJ17|RBG1L_CHICK Rab GTPase-activating protein 1-like OS=Gallus gallus GN=RABGAP1L PE=2 SV=1 507 778 1.0E-12
sp|A0A087X179|TBC3E_HUMAN TBC1 domain family member 3E OS=Homo sapiens GN=TBC1D3E PE=2 SV=1 517 782 4.0E-12
sp|A0A087X1G2|TBC3K_HUMAN TBC1 domain family member 3K OS=Homo sapiens GN=TBC1D3K PE=3 SV=1 517 782 6.0E-12
sp|A0A087WXS9|TBC3I_HUMAN TBC1 domain family member 3I OS=Homo sapiens GN=TBC1D3I PE=3 SV=1 517 782 7.0E-12
sp|Q6IPX1|TBC3C_HUMAN TBC1 domain family member 3C OS=Homo sapiens GN=TBC1D3C PE=2 SV=3 517 782 8.0E-12
sp|Q8IZP1|TBC3A_HUMAN TBC1 domain family member 3 OS=Homo sapiens GN=TBC1D3 PE=1 SV=6 517 782 8.0E-12
sp|B9A6J9|TBC3L_HUMAN TBC1 domain family member 3L OS=Homo sapiens GN=TBC1D3L PE=2 SV=1 517 782 8.0E-12
sp|A0A087WVF3|TBC3D_HUMAN TBC1 domain family member 3D OS=Homo sapiens GN=TBC1D3D PE=2 SV=1 517 782 8.0E-12
sp|Q5RAN1|RBGP1_PONAB Rab GTPase-activating protein 1 OS=Pongo abelii GN=RABGAP1 PE=2 SV=1 514 778 9.0E-12
sp|Q9Y3P9|RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens GN=RABGAP1 PE=1 SV=3 514 778 9.0E-12
sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus musculus GN=Rabgap1 PE=1 SV=1 514 778 1.0E-11
sp|A6NER0|TBC3F_HUMAN TBC1 domain family member 3F OS=Homo sapiens GN=TBC1D3F PE=2 SV=3 517 782 1.0E-11
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 514 778 2.0E-11
sp|P0C7X1|TBC3H_HUMAN TBC1 domain family member 3H OS=Homo sapiens GN=TBC1D3H PE=2 SV=3 517 782 2.0E-11
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 514 778 2.0E-11
sp|Q6DHY5|TBC3G_HUMAN TBC1 domain family member 3G OS=Homo sapiens GN=TBC1D3G PE=2 SV=2 517 782 3.0E-11
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 515 782 2.0E-10
sp|A6NDS4|TBC3B_HUMAN TBC1 domain family member 3B OS=Homo sapiens GN=TBC1D3B PE=2 SV=2 517 782 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8521
MAVSRFDNGGSIERQRSLRNRQCSVYASRIRPNLSPIAIHTNDGAPQAIQLPPLPVSPRWDSLSNGSHLILSSPT
STDEGWSEVQVPAEASLAERRGHAAPEVLKTTTNNKEVENFSRPRKQSLRPEQCVPAPRLLATPTDLSYDLCAST
PQTPPWHSPIRPSSSKPASSPFSSPLGPPPSVDLPVPKPARARNAAGPPLTAARAPLAAPASSPMAAGGAPPPPW
MAGDGLRSSFRSQLTESSAFGTAVTERSSVLTKDSSITSLYTDEPSLEDVMCMYEKGFADDDDDDDADDDDDDED
DFDIDGDSDSNRNPSASSVVTLSAADRFDTMSFVDAPARPATAMSAPLAEGRRSDAYLAPPVPAARSALDAEIRK
SKMLFVSPAFTASVPALSGAGDLDVAEKRDSGKSLDSTPSISSSDPLPPVEVKLAPVPPSPTSLFRAAMEPEDPG
SRDRYGFKKQNQSITREQYDSWNKGYTQYLARRRKKWAAYLKECGLMTDRPIRFPPPNGKTKRFVRKGIPPDWRG
AAWFYYAGGPAILAQHSGLYEKLLEREAKSIDVEAIERDLHRTFPDNIQFQPSPCPDRPRTAPAPSSDEPPIISS
LRRVLHAFAVYNPRIGYCQSLNFLAGLLLLFVETEEQCFWLLNVITVVYLPGTHEISLEGSKVDLGVLMTELRDT
MPAVWDKIGGELEAGTRAASAPAANGKPARKPRTTLWRRDQPRLSTERLPPITLCMTAWFMSCYIGTLPMETTLR
VWDVFFYEGSKTLFRIALAIFKSGEAEIKAVSDPMEMFGVVQSLPRRMLDANGLIETCFKRRNGFGHISQDAIDE
RRQERRDKAQQDREARTTPVAGDATGGDAEEAARRKGTLFGRRRRDASRTREA
Coding >Ophio5|8521
ATGGCCGTCTCCCGCTTCGATAACGGAGGCTCGATTGAGCGACAGCGGAGCCTCCGCAATCGGCAGTGTTCCGTC
TACGCCTCACGCATCAGACCCAACCTCTCGCCCATCGCCATCCACACCAACGATGGCGCGCCACAGGCGATACAG
TTACCGCCTCTGCCAGTGTCGCCGCGTTGGGACTCGCTGTCCAACGGATCGCATCTGATTCTATCGAGCCCGACA
TCGACGGACGAGGGTTGGTCGGAAGTGCAGGTACCAGCTGAGGCCAGCCTCGCTGAGCGACGAGGCCATGCGGCG
CCCGAAGTGCTCAAGACGACGACCAACAACAAAGAGGTCGAAAACTTCTCGAGGCCGCGCAAACAGAGTCTACGG
CCGGAACAATGCGTGCCGGCTCCGCGACTGCTAGCGACGCCCACGGACCTGAGCTACGACCTCTGCGCCTCGACG
CCCCAAACGCCTCCCTGGCACAGCCCCATACGCCCGTCTTCCTCCAAACCGGCCTCGTCTCCCTTTTCCTCTCCA
CTGGGGCCTCCACCGTCGGTCGACTTGCCCGTTCCCAAGCCGGCGCGCGCCCGGAACGCCGCCGGTCCGCCCCTG
ACGGCTGCCCGGGCCCCTCTGGCTGCCCCTGCGTCTTCACCCATGGCGGCCGGTGGGGCACCGCCTCCGCCCTGG
ATGGCCGGTGACGGTCTGCGTTCGAGTTTCAGGTCGCAGCTGACTGAGTCGTCTGCGTTTGGGACGGCTGTTACG
GAGCGAAGCAGCGTTCTGACAAAGGACAGCTCCATTACGTCGCTTTATACCGACGAGCCGAGTCTGGAGGATGTC
ATGTGCATGTATGAAAAGGGTTTCGCCGACGACGACGACGACGACGACGCCGACGACGACGACGACGACGAAGAC
GATTTCGACATTGACGGCGACAGCGACAGCAACCGCAACCCGTCAGCCAGCAGTGTCGTGACTCTGTCCGCCGCT
GATCGGTTCGATACGATGAGCTTCGTCGACGCGCCGGCGCGCCCTGCCACGGCCATGTCGGCTCCTCTCGCTGAA
GGACGGCGCTCCGACGCCTACCTGGCGCCTCCCGTTCCCGCTGCCCGGTCCGCGCTCGACGCCGAGATTCGAAAA
TCCAAGATGCTCTTCGTCAGTCCCGCCTTCACCGCCTCGGTGCCTGCTCTGTCCGGCGCCGGCGACCTCGACGTG
GCCGAGAAGCGCGATTCGGGCAAGTCTCTGGACTCGACGCCGTCCATCTCCTCGTCGGATCCGCTACCTCCGGTC
GAGGTCAAGCTGGCACCGGTGCCGCCTTCGCCCACGTCGCTGTTCCGCGCCGCCATGGAGCCCGAGGATCCGGGC
TCGCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTCCATCACGAGGGAGCAGTACGACTCCTGGAACAAGGGG
TACACGCAGTACCTGGCCCGACGGCGCAAGAAGTGGGCGGCCTATCTCAAGGAGTGCGGCCTCATGACGGACCGC
CCGATCCGGTTCCCGCCGCCCAACGGCAAGACCAAACGCTTCGTTCGCAAGGGCATCCCGCCCGACTGGCGCGGC
GCCGCCTGGTTCTACTACGCCGGGGGTCCGGCCATCTTGGCCCAGCACTCGGGTCTGTACGAGAAGCTGCTGGAG
CGTGAGGCCAAGTCGATCGATGTCGAGGCCATTGAGCGCGACCTGCACCGCACCTTTCCCGACAACATCCAGTTC
CAGCCGTCGCCGTGTCCGGACCGGCCGAGGACGGCACCGGCGCCGTCGTCTGACGAGCCGCCCATCATCTCGTCG
CTGCGGCGGGTGCTGCACGCCTTCGCCGTCTATAATCCGCGCATCGGCTACTGCCAGAGCCTCAACTTTTTGGCC
GGCCTGCTGCTGCTGTTCGTCGAGACGGAGGAGCAGTGCTTCTGGCTGCTCAACGTCATCACCGTCGTCTACCTG
CCCGGCACGCACGAGATTAGCCTCGAGGGCTCCAAGGTGGACCTGGGCGTGCTGATGACGGAGCTGCGGGACACG
ATGCCGGCCGTGTGGGACAAGATTGGCGGCGAGCTCGAGGCCGGCACCCGAGCGGCTTCGGCCCCGGCGGCCAAC
GGAAAGCCGGCGCGCAAGCCGAGAACGACGCTGTGGCGGCGCGATCAGCCGCGACTGTCGACGGAGAGGCTACCT
CCCATTACTCTGTGCATGACGGCCTGGTTCATGAGCTGCTACATCGGAACGCTGCCGATGGAGACGACGCTGCGC
GTATGGGACGTCTTCTTCTACGAGGGCTCCAAGACACTCTTCCGCATCGCTCTGGCCATCTTCAAGAGCGGCGAG
GCCGAGATCAAGGCCGTGTCGGACCCGATGGAGATGTTCGGCGTGGTGCAGAGCCTGCCGCGACGAATGCTGGAC
GCCAACGGTCTGATCGAGACGTGCTTCAAGCGACGCAACGGCTTCGGCCATATCAGTCAGGACGCCATCGACGAG
CGGCGACAGGAGCGGCGTGACAAGGCGCAGCAGGACCGAGAGGCGCGGACGACGCCGGTGGCGGGCGATGCGACC
GGTGGCGATGCCGAAGAGGCCGCTCGTCGGAAGGGCACCTTGTTCGGACGGCGGCGAAGAGATGCTTCGCGGACG
CGGGAGGCG
Transcript >Ophio5|8521
ATGGCCGTCTCCCGCTTCGATAACGGAGGCTCGATTGAGCGACAGCGGAGCCTCCGCAATCGGCAGTGTTCCGTC
TACGCCTCACGCATCAGACCCAACCTCTCGCCCATCGCCATCCACACCAACGATGGCGCGCCACAGGCGATACAG
TTACCGCCTCTGCCAGTGTCGCCGCGTTGGGACTCGCTGTCCAACGGATCGCATCTGATTCTATCGAGCCCGACA
TCGACGGACGAGGGTTGGTCGGAAGTGCAGGTACCAGCTGAGGCCAGCCTCGCTGAGCGACGAGGCCATGCGGCG
CCCGAAGTGCTCAAGACGACGACCAACAACAAAGAGGTCGAAAACTTCTCGAGGCCGCGCAAACAGAGTCTACGG
CCGGAACAATGCGTGCCGGCTCCGCGACTGCTAGCGACGCCCACGGACCTGAGCTACGACCTCTGCGCCTCGACG
CCCCAAACGCCTCCCTGGCACAGCCCCATACGCCCGTCTTCCTCCAAACCGGCCTCGTCTCCCTTTTCCTCTCCA
CTGGGGCCTCCACCGTCGGTCGACTTGCCCGTTCCCAAGCCGGCGCGCGCCCGGAACGCCGCCGGTCCGCCCCTG
ACGGCTGCCCGGGCCCCTCTGGCTGCCCCTGCGTCTTCACCCATGGCGGCCGGTGGGGCACCGCCTCCGCCCTGG
ATGGCCGGTGACGGTCTGCGTTCGAGTTTCAGGTCGCAGCTGACTGAGTCGTCTGCGTTTGGGACGGCTGTTACG
GAGCGAAGCAGCGTTCTGACAAAGGACAGCTCCATTACGTCGCTTTATACCGACGAGCCGAGTCTGGAGGATGTC
ATGTGCATGTATGAAAAGGGTTTCGCCGACGACGACGACGACGACGACGCCGACGACGACGACGACGACGAAGAC
GATTTCGACATTGACGGCGACAGCGACAGCAACCGCAACCCGTCAGCCAGCAGTGTCGTGACTCTGTCCGCCGCT
GATCGGTTCGATACGATGAGCTTCGTCGACGCGCCGGCGCGCCCTGCCACGGCCATGTCGGCTCCTCTCGCTGAA
GGACGGCGCTCCGACGCCTACCTGGCGCCTCCCGTTCCCGCTGCCCGGTCCGCGCTCGACGCCGAGATTCGAAAA
TCCAAGATGCTCTTCGTCAGTCCCGCCTTCACCGCCTCGGTGCCTGCTCTGTCCGGCGCCGGCGACCTCGACGTG
GCCGAGAAGCGCGATTCGGGCAAGTCTCTGGACTCGACGCCGTCCATCTCCTCGTCGGATCCGCTACCTCCGGTC
GAGGTCAAGCTGGCACCGGTGCCGCCTTCGCCCACGTCGCTGTTCCGCGCCGCCATGGAGCCCGAGGATCCGGGC
TCGCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTCCATCACGAGGGAGCAGTACGACTCCTGGAACAAGGGG
TACACGCAGTACCTGGCCCGACGGCGCAAGAAGTGGGCGGCCTATCTCAAGGAGTGCGGCCTCATGACGGACCGC
CCGATCCGGTTCCCGCCGCCCAACGGCAAGACCAAACGCTTCGTTCGCAAGGGCATCCCGCCCGACTGGCGCGGC
GCCGCCTGGTTCTACTACGCCGGGGGTCCGGCCATCTTGGCCCAGCACTCGGGTCTGTACGAGAAGCTGCTGGAG
CGTGAGGCCAAGTCGATCGATGTCGAGGCCATTGAGCGCGACCTGCACCGCACCTTTCCCGACAACATCCAGTTC
CAGCCGTCGCCGTGTCCGGACCGGCCGAGGACGGCACCGGCGCCGTCGTCTGACGAGCCGCCCATCATCTCGTCG
CTGCGGCGGGTGCTGCACGCCTTCGCCGTCTATAATCCGCGCATCGGCTACTGCCAGAGCCTCAACTTTTTGGCC
GGCCTGCTGCTGCTGTTCGTCGAGACGGAGGAGCAGTGCTTCTGGCTGCTCAACGTCATCACCGTCGTCTACCTG
CCCGGCACGCACGAGATTAGCCTCGAGGGCTCCAAGGTGGACCTGGGCGTGCTGATGACGGAGCTGCGGGACACG
ATGCCGGCCGTGTGGGACAAGATTGGCGGCGAGCTCGAGGCCGGCACCCGAGCGGCTTCGGCCCCGGCGGCCAAC
GGAAAGCCGGCGCGCAAGCCGAGAACGACGCTGTGGCGGCGCGATCAGCCGCGACTGTCGACGGAGAGGCTACCT
CCCATTACTCTGTGCATGACGGCCTGGTTCATGAGCTGCTACATCGGAACGCTGCCGATGGAGACGACGCTGCGC
GTATGGGACGTCTTCTTCTACGAGGGCTCCAAGACACTCTTCCGCATCGCTCTGGCCATCTTCAAGAGCGGCGAG
GCCGAGATCAAGGCCGTGTCGGACCCGATGGAGATGTTCGGCGTGGTGCAGAGCCTGCCGCGACGAATGCTGGAC
GCCAACGGTCTGATCGAGACGTGCTTCAAGCGACGCAACGGCTTCGGCCATATCAGTCAGGACGCCATCGACGAG
CGGCGACAGGAGCGGCGTGACAAGGCGCAGCAGGACCGAGAGGCGCGGACGACGCCGGTGGCGGGCGATGCGACC
GGTGGCGATGCCGAAGAGGCCGCTCGTCGGAAGGGCACCTTGTTCGGACGGCGGCGAAGAGATGCTTCGCGGACG
CGGGAGGCGTAG
Gene >Ophio5|8521
ATGGCCGTCTCCCGCTTCGATAACGGAGGCTCGATTGAGCGACAGCGGAGCCTCCGCAATCGGCAGTGTTCCGTC
TACGCCTCACGCATCAGACCCAACCTCTCGCCCATCGCCATCCACACCAACGATGGCGCGCCACAGGCGATACAG
TTACCGCCTCTGCCAGTGTCGCCGCGTTGGGACTCGCTGTCCAACGGATCGCATCTGATTCTATCGAGCCCGACA
TCGACGGACGAGGGTTGGTCGGAAGTGCAGGTACCAGCTGAGGCCAGCCTCGCTGAGCGACGAGGCCATGCGGCG
CCCGAAGTGCTCAAGACGACGACCAACAACAAAGAGGTCGAAAACTTCTCGAGGCCGCGCAAACAGAGTCTACGG
CCGGAACAATGCGTGCCGGCTCCGCGACTGCTAGCGACGCCCACGGACCTGAGCTACGACCTCTGCGCCTCGACG
CCCCAAACGCCTCCCTGGCACAGCCCCATACGCCCGTCTTCCTCCAAACCGGCCTCGTCTCCCTTTTCCTCTCCA
CTGGGGCCTCCACCGTCGGTCGACTTGCCCGTTCCCAAGCCGGCGCGCGCCCGGAACGCCGCCGGTCCGCCCCTG
ACGGCTGCCCGGGCCCCTCTGGCTGCCCCTGCGTCTTCACCCATGGCGGCCGGTGGGGCACCGCCTCCGCCCTGG
ATGGCCGGTGACGGTCTGCGTTCGAGTTTCAGGTCGCAGCTGACTGAGTCGTCTGCGTTTGGGACGGCTGTTACG
GAGCGAAGCAGCGTTCTGACAAAGGACAGCTCCATTACGTCGCTTTATACCGACGAGCCGAGTCTGGAGGATGTC
ATGTGCATGTATGAAAAGGGTTTCGCCGACGACGACGACGACGACGACGCCGACGACGACGACGACGACGAAGAC
GATTTCGACATTGACGGCGACAGCGACAGCAACCGCAACCCGTCAGCCAGCAGTGTCGTGACTCTGTCCGCCGCT
GATCGGTTCGATACGATGAGCTTCGTCGACGCGCCGGCGCGCCCTGCCACGGCCATGTCGGCTCCTCTCGCTGAA
GGACGGCGCTCCGACGCCTACCTGGCGCCTCCCGTTCCCGCTGCCCGGTCCGCGCTCGACGCCGAGATTCGAAAA
TCCAAGATGCTCTTCGTCAGTCCCGCCTTCACCGCCTCGGTGCCTGCTCTGTCCGGCGCCGGCGACCTCGACGTG
GCCGAGAAGCGCGATTCGGGCAAGTCTCTGGACTCGACGCCGTCCATCTCCTCGTCGGATCCGCTACCTCCGGTC
GAGGTCAAGCTGGCACCGGTGCCGCCTTCGCCCACGTCGCTGTTCCGCGCCGCCATGGAGCCCGAGGATCCGGGC
TCGCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTCCATCACGAGGGAGCAGTACGACTCCTGGAACAAGGGG
TACACGCAGTACCTGGCCCGACGGCGCAAGAAGTGGGCGGCCTATCTCAAGGAGTGCGGCCTCATGACGGACCGC
CCGATCCGGTTCCCGCCGCCCAACGGCAAGACCAAACGCTTCGTTCGCAAGGGCATCCCGCCCGACTGGCGCGGC
GCCGCCTGGTTCTACTACGCCGGGGGTCCGGCCATCTTGGCCCAGCACTCGGGTCTGTACGAGAAGCTGCTGGAG
CGTGAGGCCAAGTCGATCGATGTCGAGGCCATTGAGCGCGACCTGCACCGCACCTTTCCCGACAACATCCAGTTC
CAGCCGTCGCCGTGTCCGGACCGGCCGAGGACGGCACCGGCGCCGTCGTCTGACGAGCCGCCCATCATCTCGTCG
CTGCGGCGGGTGCTGCACGCCTTCGCCGTCTATAATCCGCGCATCGGCTACTGCCAGAGCCTCAACTTTTTGGCC
GGCCTGCTGCTGCTGTTCGTCGAGACGGAGGAGCAGTGCTTCTGGCTGCTCAACGTCATCACCGTCGTCTACCTG
CCCGGCACGCACGAGATTAGCCTCGAGGGCTCCAAGGTGGACCTGGGCGTGCTGATGACGGAGCTGCGGGACACG
ATGCCGGCCGTGTGGGACAAGATTGGCGGCGAGCTCGAGGCCGGCACCCGAGCGGCTTCGGCCCCGGCGGCCAAC
GGAAAGCCGGCGCGCAAGCCGAGAACGACGCTGTGGCGGCGCGATCAGCCGCGACTGTCGACGGAGAGGCTACCT
CCCATTACTCTGTGCATGACGGCCTGGTTCATGAGCTGCTACATCGGAACGCTGCCGATGGAGACGACGCTGCGC
GTATGGGACGTCTTCTTCTACGAGGGCTCCAAGACACTCTTCCGCATCGCTCTGGCCATCTTCAAGAGCGGCGAG
GCCGAGATCAAGGCCGTGTCGGACCCGATGGAGATGTTCGGCGTGGTGCAGAGCCTGCCGCGACGAATGCTGGAC
GCCAACGGTCTGATCGAGACGTGCTTCAAGCGACGCAACGGCTTCGGCCATATCAGTCAGGACGCCATCGACGAG
CGGCGACAGGAGCGGCGTGACAAGGCGCAGCAGGACCGAGAGGCGCGGACGACGCCGGTGGCGGGCGATGCGACC
GGTGGCGATGCCGAAGAGGCCGCTCGTCGGAAGGGCACCTTGTTCGGACGGCGGCGAAGAGATGCTTCGCGGACG
CGGGAGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail