Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8518
Gene name
Locationscaffold_96:40171..42229
Strand+
Gene length (bp)2058
Transcript length (bp)1713
Coding sequence length (bp)1710
Protein length (aa) 570

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.6E-06 121 224

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 65 275 7.0E-18
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 55 274 6.0E-12

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 92 114 22
2 124 146 22
3 153 172 19
4 246 268 22
5 327 349 22
6 359 381 22
7 394 416 22
8 443 462 19
9 493 515 22
10 519 541 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8518
MMDWAFRNKPVATIVAEPPLARYPPSSSLRSLSTIRSLPMTGSSHSLSFASEPRKSHVVKYGSGRDADVELIPQP
SDAPDDPLNWPLWRKHLNLASLLVSVVLVGGMKTALLPTAGSRHGQVSVAALTSVPLALAAVGGIGSCVAAKRLG
KRPLYLASAVVALIGCVWSAATADDGFASSVGARVLQGLGWGAFDTLLLGSIQDTYFEHERNLPVTLYNMLTTAS
TWATPLIAGLSSSLTPANPPAAPFRLISALHLVSLPLLLLGAPETVFDRSGPGPVVSGPAPPMQLAGYVRHVIRL
RRPWSSSSASSALQAARAIVAPSTCLVSALSAVPYAALWGLAAVGAMVVTPQPLGLGPVAVGALLSGPWLLASAV
VGGLACFYRGFHDRFTRRASCIVVAVGAFLVVVGLLSFGLGLDNFMIRAKSSPASSPPFFTPTAARQLSPPLLAL
QLGILAAGIHVLDTATRPLLARSASFTSPTVAAAHRSIGDMHAAIVAIRSLAAAIGIAALPAMPLRPAVIAMTVV
HTLVVPAVLFLCSYAGEAVWRADGRVLGQVDVRLLKQSGSFFDHD
Coding >Ophio5|8518
ATGATGGACTGGGCCTTTCGAAACAAGCCCGTGGCGACTATTGTTGCCGAGCCGCCTCTGGCGCGCTATCCACCT
TCTTCGTCGCTCCGTTCGCTGAGCACCATCCGCTCGCTCCCCATGACGGGCTCCTCCCACAGCCTGTCGTTTGCT
TCGGAGCCGAGGAAGAGCCATGTCGTCAAGTACGGCTCCGGCCGTGATGCAGATGTCGAACTCATCCCTCAGCCC
AGCGACGCACCGGACGATCCGCTAAACTGGCCGCTGTGGAGAAAGCATCTGAATCTCGCCTCGCTCCTCGTCTCC
GTCGTCCTCGTCGGCGGTATGAAGACGGCCCTTTTGCCGACGGCTGGATCCCGTCACGGCCAAGTCTCCGTCGCC
GCCCTGACGTCGGTGCCCCTGGCTCTCGCGGCCGTCGGCGGCATCGGCAGCTGCGTCGCCGCCAAACGTCTGGGC
AAGCGCCCACTGTACCTGGCCTCGGCTGTCGTCGCCCTCATAGGCTGCGTGTGGAGTGCGGCGACGGCAGACGAT
GGCTTCGCGTCGTCTGTGGGCGCTCGCGTGCTGCAGGGCCTGGGCTGGGGCGCTTTCGACACGCTGCTGCTGGGG
TCTATCCAGGACACGTACTTTGAACACGAGCGCAACCTCCCCGTAACCCTCTACAACATGCTCACCACAGCCTCG
ACCTGGGCCACGCCCCTAATCGCCGGCCTCAGCTCGAGCCTCACTCCGGCCAACCCCCCAGCCGCGCCCTTCCGC
CTCATCAGCGCCCTACATCTCGTCTCCCTTCCGCTCCTCCTCTTGGGCGCTCCGGAAACCGTCTTCGACCGCTCT
GGTCCCGGTCCCGTGGTGTCCGGTCCGGCACCACCGATGCAGCTCGCCGGTTACGTCCGCCATGTGATCCGCCTC
CGCCGTCCTTGGTCATCTTCGTCGGCGTCGTCTGCTCTTCAGGCCGCCCGTGCCATTGTTGCGCCATCAACCTGC
CTCGTTTCTGCTCTCTCGGCTGTGCCCTATGCCGCACTTTGGGGGCTTGCCGCTGTTGGTGCCATGGTCGTGACG
CCGCAGCCGCTGGGGCTCGGTCCTGTTGCCGTGGGAGCGCTTCTATCCGGGCCCTGGCTGTTGGCGTCGGCTGTT
GTTGGCGGTCTCGCTTGCTTCTACCGTGGCTTCCACGATCGCTTCACCCGTCGTGCCAGCTGCATCGTCGTCGCT
GTCGGCGCCTTTCTCGTCGTCGTCGGTTTGCTCTCCTTTGGTCTCGGCCTCGATAACTTCATGATCAGGGCCAAA
TCCTCCCCTGCCTCGTCACCCCCTTTCTTCACTCCCACGGCCGCTCGCCAGCTCTCCCCCCCTCTTCTCGCCCTA
CAACTCGGCATCCTTGCGGCCGGCATACACGTCCTTGACACGGCCACTCGTCCTCTCCTCGCCCGCTCCGCCTCC
TTTACCTCGCCCACCGTCGCCGCAGCACATCGCTCCATCGGAGACATGCACGCCGCCATCGTTGCCATCCGGAGC
CTCGCCGCCGCCATAGGAATCGCCGCTCTCCCCGCTATGCCCCTGCGTCCTGCTGTCATCGCCATGACCGTCGTC
CATACTCTCGTCGTCCCTGCCGTCCTTTTCCTCTGTTCCTATGCCGGCGAAGCCGTCTGGCGCGCTGACGGACGT
GTTCTCGGCCAAGTCGACGTGCGTCTGCTCAAGCAGTCTGGCAGCTTCTTCGACCACGAC
Transcript >Ophio5|8518
ATGATGGACTGGGCCTTTCGAAACAAGCCCGTGGCGACTATTGTTGCCGAGCCGCCTCTGGCGCGCTATCCACCT
TCTTCGTCGCTCCGTTCGCTGAGCACCATCCGCTCGCTCCCCATGACGGGCTCCTCCCACAGCCTGTCGTTTGCT
TCGGAGCCGAGGAAGAGCCATGTCGTCAAGTACGGCTCCGGCCGTGATGCAGATGTCGAACTCATCCCTCAGCCC
AGCGACGCACCGGACGATCCGCTAAACTGGCCGCTGTGGAGAAAGCATCTGAATCTCGCCTCGCTCCTCGTCTCC
GTCGTCCTCGTCGGCGGTATGAAGACGGCCCTTTTGCCGACGGCTGGATCCCGTCACGGCCAAGTCTCCGTCGCC
GCCCTGACGTCGGTGCCCCTGGCTCTCGCGGCCGTCGGCGGCATCGGCAGCTGCGTCGCCGCCAAACGTCTGGGC
AAGCGCCCACTGTACCTGGCCTCGGCTGTCGTCGCCCTCATAGGCTGCGTGTGGAGTGCGGCGACGGCAGACGAT
GGCTTCGCGTCGTCTGTGGGCGCTCGCGTGCTGCAGGGCCTGGGCTGGGGCGCTTTCGACACGCTGCTGCTGGGG
TCTATCCAGGACACGTACTTTGAACACGAGCGCAACCTCCCCGTAACCCTCTACAACATGCTCACCACAGCCTCG
ACCTGGGCCACGCCCCTAATCGCCGGCCTCAGCTCGAGCCTCACTCCGGCCAACCCCCCAGCCGCGCCCTTCCGC
CTCATCAGCGCCCTACATCTCGTCTCCCTTCCGCTCCTCCTCTTGGGCGCTCCGGAAACCGTCTTCGACCGCTCT
GGTCCCGGTCCCGTGGTGTCCGGTCCGGCACCACCGATGCAGCTCGCCGGTTACGTCCGCCATGTGATCCGCCTC
CGCCGTCCTTGGTCATCTTCGTCGGCGTCGTCTGCTCTTCAGGCCGCCCGTGCCATTGTTGCGCCATCAACCTGC
CTCGTTTCTGCTCTCTCGGCTGTGCCCTATGCCGCACTTTGGGGGCTTGCCGCTGTTGGTGCCATGGTCGTGACG
CCGCAGCCGCTGGGGCTCGGTCCTGTTGCCGTGGGAGCGCTTCTATCCGGGCCCTGGCTGTTGGCGTCGGCTGTT
GTTGGCGGTCTCGCTTGCTTCTACCGTGGCTTCCACGATCGCTTCACCCGTCGTGCCAGCTGCATCGTCGTCGCT
GTCGGCGCCTTTCTCGTCGTCGTCGGTTTGCTCTCCTTTGGTCTCGGCCTCGATAACTTCATGATCAGGGCCAAA
TCCTCCCCTGCCTCGTCACCCCCTTTCTTCACTCCCACGGCCGCTCGCCAGCTCTCCCCCCCTCTTCTCGCCCTA
CAACTCGGCATCCTTGCGGCCGGCATACACGTCCTTGACACGGCCACTCGTCCTCTCCTCGCCCGCTCCGCCTCC
TTTACCTCGCCCACCGTCGCCGCAGCACATCGCTCCATCGGAGACATGCACGCCGCCATCGTTGCCATCCGGAGC
CTCGCCGCCGCCATAGGAATCGCCGCTCTCCCCGCTATGCCCCTGCGTCCTGCTGTCATCGCCATGACCGTCGTC
CATACTCTCGTCGTCCCTGCCGTCCTTTTCCTCTGTTCCTATGCCGGCGAAGCCGTCTGGCGCGCTGACGGACGT
GTTCTCGGCCAAGTCGACGTGCGTCTGCTCAAGCAGTCTGGCAGCTTCTTCGACCACGACTGA
Gene >Ophio5|8518
ATGATGGACTGGGCCTTTCGAAACAAGCCCGTGGCGACTATTGTTGCCGAGCCGCCTCTGGCGCGCTATCCACCT
TCTTCGTCGCTCCGTTCGCTGAGCACCATCCGCTCGCTCCCCATGACGGGCTCCTCCCACAGCCTGTCGTTTGCT
TCGGAGCCGAGGAAGAGCCATGTCGTCAAGTACGGCTCCGGCCGTGATGCAGATGTCGAACTCATCCCTCAGCCC
AGCGACGCACCGGACGATCCGCTAGTCTGACTCTCGCTTCCTAATAGTCTCGAGACAACGAAGCTGACGCGTCGC
AGAACTGGCCGCTGTGGAGAAAGCATCTGAATCTCGCCTCGCTCCTCGTCTCCGTCGTCCTCGTCGGCGGTATGA
AGACGGCCCTTTTGCCGACGGCTGGATCCCGTCACGGCCAAGTCTCCGTCGCCGCCCTGACGTCGGTGCCCCTGG
CTCTCGCGGCCGTCGGCGGCATCGGCAGCTGCGTCGCCGCCAAACGTCTGGGCAAGCGCCCACTGTACCTGGCCT
CGGCTGTCGTCGCCCTCATAGGCTGCGTGTGGAGTGCGGCGACGGCAGACGATGGCTTCGCGTCGTCTGTGGGCG
CTCGCGTGCTGCAGGGCCTGGGCTGGGGCGCTTTCGACACGCTGCTGCTGGGGTCTATCCAGGACACGTACTTTG
TAAGATTGCTGTTCTGTCAACATGTCTTCATCACCATCAAGCTCTCCTCTTCCTGCTGTTTTACTCTCTCGCCAA
CTCAGTCTCACTCACTCACTATCCTTTCACAACCTCAAATGCTCTACTCTACTCTCTCCCCTCCCTTCTTCACTC
TCAGAAGCTTGACTTATTCTTCTTCTTCTTCATCCCCAGTCTTCTCTCCTCTCACAGCCCACTATCCCCCCTCAA
CCATCCTCACCAATATAGAAAACCCCGTCCGACCATCCTCACCAATGTAGAAACTAATAATATCAGGAACACGAG
CGCAACCTCCCCGTAACCCTCTACAACATGCTCACCACAGCCTCGACCTGGGCCACGCCCCTAATCGCCGGCCTC
AGCTCGAGCCTCACTCCGGCCAACCCCCCAGCCGCGCCCTTCCGCCTCATCAGCGCCCTACATCTCGTCTCCCTT
CCGCTCCTCCTCTTGGGCGCTCCGGAAACCGTCTTCGACCGCTCTGGTCCCGGTCCCGTGGTGTCCGGTCCGGCA
CCACCGATGCAGCTCGCCGGTTACGTCCGCCATGTGATCCGCCTCCGCCGTCCTTGGTCATCTTCGTCGGCGTCG
TCTGCTCTTCAGGCCGCCCGTGCCATTGTTGCGCCATCAACCTGCCTCGTTTCTGCTCTCTCGGCTGTGCCCTAT
GCCGCACTTTGGGGGCTTGCCGCTGTTGGTGCCATGGTCGTGACGCCGCAGCCGCTGGGGCTCGGTCCTGTTGCC
GTGGGAGCGCTTCTATCCGGGCCCTGGCTGTTGGCGTCGGCTGTTGTTGGCGGTCTCGCTTGCTTCTACCGTGGC
TTCCACGATCGCTTCACCCGTCGTGCCAGCTGCATCGTCGTCGCTGTCGGCGCCTTTCTCGTCGTCGTCGGTTTG
CTCTCCTTTGGTCTCGGCCTCGATAACTTCATGATCAGGGCCAAATCCTCCCCTGCCTCGTCACCCCCTTTCTTC
ACTCCCACGGCCGCTCGCCAGCTCTCCCCCCCTCTTCTCGCCCTACAACTCGGCATCCTTGCGGCCGGCATACAC
GTCCTTGACACGGCCACTCGTCCTCTCCTCGCCCGCTCCGCCTCCTTTACCTCGCCCACCGTCGCCGCAGCACAT
CGCTCCATCGGAGACATGCACGCCGCCATCGTTGCCATCCGGAGCCTCGCCGCCGCCATAGGAATCGCCGCTCTC
CCCGCTATGCCCCTGCGTCCTGCTGTCATCGCCATGACCGTCGTCCATACTCTCGTCGTCCCTGCCGTCCTTTTC
CTCTGTTCCTATGCCGGCGAAGCCGTCTGGCGCGCTGACGGACGTGTTCTCGGCCAAGTCGACGTGCGTCTGCTC
AAGCAGTCTGGCAGCTTCTTCGACCACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail