Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8516
Gene name
Locationscaffold_96:34546..37035
Strand+
Gene length (bp)2489
Transcript length (bp)2361
Coding sequence length (bp)2358
Protein length (aa) 786

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00916 Sulfate_transp Sulfate permease family 1.8E-103 78 468
PF01740 STAS STAS domain 1.0E-06 550 651

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23622|CYS14_NEUCR Sulfate permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-14 PE=2 SV=3 25 760 0.0E+00
sp|Q9URY8|SULH2_SCHPO Probable sulfate permease C869.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.05c PE=1 SV=1 33 754 5.0E-168
sp|O74377|SULH1_SCHPO Probable sulfate permease C3H7.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.02 PE=3 SV=1 31 729 7.0E-161
sp|P38359|SUL1_YEAST Sulfate permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL1 PE=1 SV=2 25 752 7.0E-132
sp|Q12325|SUL2_YEAST Sulfate permease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL2 PE=1 SV=1 17 752 3.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23622|CYS14_NEUCR Sulfate permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-14 PE=2 SV=3 25 760 0.0E+00
sp|Q9URY8|SULH2_SCHPO Probable sulfate permease C869.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.05c PE=1 SV=1 33 754 5.0E-168
sp|O74377|SULH1_SCHPO Probable sulfate permease C3H7.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.02 PE=3 SV=1 31 729 7.0E-161
sp|P38359|SUL1_YEAST Sulfate permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL1 PE=1 SV=2 25 752 7.0E-132
sp|Q12325|SUL2_YEAST Sulfate permease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL2 PE=1 SV=1 17 752 3.0E-122
sp|Q80ZD3|S2611_MOUSE Sodium-independent sulfate anion transporter OS=Mus musculus GN=Slc26a11 PE=2 SV=2 49 501 3.0E-52
sp|Q9SV13|SUT31_ARATH Sulfate transporter 3.1 OS=Arabidopsis thaliana GN=SULTR3;1 PE=2 SV=1 63 696 1.0E-51
sp|Q86WA9|S2611_HUMAN Sodium-independent sulfate anion transporter OS=Homo sapiens GN=SLC26A11 PE=2 SV=2 64 499 1.0E-51
sp|P53392|SUT2_STYHA High affinity sulfate transporter 2 OS=Stylosanthes hamata GN=ST2 PE=2 SV=1 33 649 3.0E-50
sp|Q58DD2|S2611_BOVIN Sodium-independent sulfate anion transporter OS=Bos taurus GN=SLC26A11 PE=2 SV=1 65 501 5.0E-50
sp|Q9FY46|SUT41_ARATH Sulfate transporter 4.1, chloroplastic OS=Arabidopsis thaliana GN=SULTR4;1 PE=1 SV=1 63 508 5.0E-50
sp|Q8GYH8|SUT42_ARATH Probable sulfate transporter 4.2 OS=Arabidopsis thaliana GN=SULTR4;2 PE=2 SV=2 63 508 2.0E-49
sp|P53391|SUT1_STYHA High affinity sulfate transporter 1 OS=Stylosanthes hamata GN=ST1 PE=2 SV=1 63 508 8.0E-49
sp|A8J6J0|SULT2_CHLRE Proton/sulfate cotransporter 2 OS=Chlamydomonas reinhardtii GN=SULTR2 PE=2 SV=1 59 651 1.0E-48
sp|Q9H2B4|S26A1_HUMAN Sulfate anion transporter 1 OS=Homo sapiens GN=SLC26A1 PE=1 SV=2 58 644 3.0E-48
sp|P53393|SUT3_STYHA Low affinity sulfate transporter 3 OS=Stylosanthes hamata GN=ST3 PE=2 SV=1 58 667 1.0E-46
sp|Q9SAY1|SUT11_ARATH Sulfate transporter 1.1 OS=Arabidopsis thaliana GN=SULTR1;1 PE=1 SV=2 63 650 1.0E-46
sp|O04722|SUT21_ARATH Sulfate transporter 2.1 OS=Arabidopsis thaliana GN=SULTR2;1 PE=2 SV=1 63 647 2.0E-45
sp|P92946|SUT22_ARATH Sulfate transporter 2.2 OS=Arabidopsis thaliana GN=SULTR2;2 PE=1 SV=3 64 508 3.0E-45
sp|Q9LW86|SUT34_ARATH Probable sulfate transporter 3.4 OS=Arabidopsis thaliana GN=SULTR3;4 PE=2 SV=1 60 651 2.0E-44
sp|P58735|S26A1_MOUSE Sulfate anion transporter 1 OS=Mus musculus GN=Slc26a1 PE=1 SV=1 63 644 1.0E-42
sp|Q8CIW6|S26A6_MOUSE Solute carrier family 26 member 6 OS=Mus musculus GN=Slc26a6 PE=1 SV=2 44 508 1.0E-42
sp|Q9FEP7|SUT13_ARATH Sulfate transporter 1.3 OS=Arabidopsis thaliana GN=SULTR1;3 PE=2 SV=1 63 649 2.0E-42
sp|Q9SXS2|SUT33_ARATH Probable sulfate transporter 3.3 OS=Arabidopsis thaliana GN=SULTR3;3 PE=2 SV=2 33 508 1.0E-41
sp|O43511|S26A4_HUMAN Pendrin OS=Homo sapiens GN=SLC26A4 PE=1 SV=1 36 473 1.0E-40
sp|Q9BXS9|S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo sapiens GN=SLC26A6 PE=1 SV=1 40 508 7.0E-40
sp|A6QNW6|S26A8_BOVIN Testis anion transporter 1 OS=Bos taurus GN=SLC26A8 PE=2 SV=1 48 508 2.0E-39
sp|P40879|S26A3_HUMAN Chloride anion exchanger OS=Homo sapiens GN=SLC26A3 PE=1 SV=1 60 649 9.0E-39
sp|O04289|SUT32_ARATH Sulfate transporter 3.2 OS=Arabidopsis thaliana GN=SULTR3;2 PE=2 SV=1 60 509 9.0E-39
sp|Q94LW6|SUT35_ARATH Probable sulfate transporter 3.5 OS=Arabidopsis thaliana GN=SULTR3;5 PE=2 SV=1 65 508 2.0E-38
sp|P45380|S26A1_RAT Sulfate anion transporter 1 OS=Rattus norvegicus GN=Slc26a1 PE=1 SV=1 63 508 2.0E-38
sp|Q02920|NO70_SOYBN Early nodulin-70 OS=Glycine max PE=2 SV=1 58 485 5.0E-38
sp|Q9R155|S26A4_MOUSE Pendrin OS=Mus musculus GN=Slc26a4 PE=1 SV=1 63 474 7.0E-37
sp|Q9JKQ2|S26A5_MERUN Prestin OS=Meriones unguiculatus GN=SLC26A5 PE=1 SV=1 63 576 8.0E-37
sp|Q9R154|S26A4_RAT Pendrin OS=Rattus norvegicus GN=Slc26a4 PE=2 SV=1 63 474 1.0E-36
sp|Q9MAX3|SUT12_ARATH Sulfate transporter 1.2 OS=Arabidopsis thaliana GN=SULTR1;2 PE=1 SV=1 60 649 2.0E-36
sp|Q99NH7|S26A5_MOUSE Prestin OS=Mus musculus GN=Slc26a5 PE=2 SV=3 63 576 2.0E-36
sp|P58743|S26A5_HUMAN Prestin OS=Homo sapiens GN=SLC26A5 PE=2 SV=1 63 615 5.0E-36
sp|Q9EPH0|S26A5_RAT Prestin OS=Rattus norvegicus GN=Slc26a5 PE=1 SV=1 63 576 7.0E-36
sp|Q8R0C3|S26A8_MOUSE Testis anion transporter 1 OS=Mus musculus GN=Slc26a8 PE=2 SV=2 48 508 2.0E-35
sp|Q96RN1|S26A8_HUMAN Testis anion transporter 1 OS=Homo sapiens GN=SLC26A8 PE=1 SV=1 48 508 3.0E-35
sp|Q924C9|S26A3_RAT Chloride anion exchanger OS=Rattus norvegicus GN=Slc26a3 PE=2 SV=1 61 640 1.0E-34
sp|Q62273|S26A2_MOUSE Sulfate transporter OS=Mus musculus GN=Slc26a2 PE=1 SV=1 62 506 5.0E-34
sp|O70531|S26A2_RAT Sulfate transporter OS=Rattus norvegicus GN=Slc26a2 PE=2 SV=1 60 506 2.0E-33
sp|Q4R445|S26A8_MACFA Testis anion transporter 1 OS=Macaca fascicularis GN=SLC26A8 PE=2 SV=1 60 508 2.0E-32
sp|Q69DJ1|S26A2_BUBBU Sulfate transporter OS=Bubalus bubalis GN=SLC26A2 PE=3 SV=1 63 644 5.0E-32
sp|Q8R2Z3|S26A7_MOUSE Anion exchange transporter OS=Mus musculus GN=Slc26a7 PE=2 SV=3 64 501 7.0E-32
sp|P50443|S26A2_HUMAN Sulfate transporter OS=Homo sapiens GN=SLC26A2 PE=1 SV=2 48 644 9.0E-32
sp|Q9BEG8|S26A2_BOVIN Sulfate transporter OS=Bos taurus GN=SLC26A2 PE=3 SV=1 63 719 1.0E-31
sp|Q7LBE3|S26A9_HUMAN Solute carrier family 26 member 9 OS=Homo sapiens GN=SLC26A9 PE=1 SV=1 54 508 1.0E-31
sp|Q65AC2|S26A2_HORSE Sulfate transporter OS=Equus caballus GN=SLC26A2 PE=2 SV=1 48 715 2.0E-31
sp|Q8BU91|S26A9_MOUSE Solute carrier family 26 member 9 OS=Mus musculus GN=Slc26a9 PE=2 SV=1 54 508 3.0E-31
sp|Q5RAL2|S26A7_PONAB Anion exchange transporter OS=Pongo abelii GN=SLC26A7 PE=2 SV=1 64 500 1.0E-30
sp|Q9WVC8|S26A3_MOUSE Chloride anion exchanger OS=Mus musculus GN=Slc26a3 PE=1 SV=1 61 525 2.0E-30
sp|P53394|SULX_YEAST Putative sulfate transporter YPR003C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR003C PE=1 SV=1 65 676 2.0E-30
sp|Q9GJY3|S26A2_SHEEP Sulfate transporter OS=Ovis aries GN=SLC26A2 PE=3 SV=1 63 527 2.0E-30
sp|Q8TE54|S26A7_HUMAN Anion exchange transporter OS=Homo sapiens GN=SLC26A7 PE=2 SV=2 64 499 8.0E-30
sp|Q5EBI0|S2610_MOUSE Solute carrier family 26 member 10 OS=Mus musculus GN=Slc26a10 PE=2 SV=1 50 459 1.0E-29
sp|Q94225|SULP3_CAEEL Sulfate permease family protein 3 OS=Caenorhabditis elegans GN=sulp-3 PE=2 SV=3 60 524 6.0E-28
sp|A4IIF2|S26A9_XENTR Solute carrier family 26 member 9 OS=Xenopus tropicalis GN=slc26a9 PE=2 SV=1 59 508 2.0E-27
sp|P9WGF6|Y1739_MYCTO Probable sulfate transporter MT1781 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1781 PE=3 SV=1 65 508 1.0E-25
sp|P9WGF7|Y1739_MYCTU Probable sulfate transporter Rv1739c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1739c PE=1 SV=1 65 508 3.0E-25
sp|Q8NG04|S2610_HUMAN Solute carrier family 26 member 10 OS=Homo sapiens GN=SLC26A10 PE=2 SV=1 96 485 1.0E-22
sp|O06984|YVDB_BACSU Putative sulfate transporter YvdB OS=Bacillus subtilis (strain 168) GN=yvdB PE=3 SV=1 71 512 6.0E-19
sp|O59782|SULH3_SCHPO Probable sulfate permease C320.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.05 PE=3 SV=1 65 576 6.0E-18
sp|P55189|YBAR_BACSU Putative sulfate transporter YbaR OS=Bacillus subtilis (strain 168) GN=ybaR PE=3 SV=2 74 501 9.0E-17
sp|P0AFR2|DAUA_ECOLI C4-dicarboxylic acid transporter DauA OS=Escherichia coli (strain K12) GN=dauA PE=1 SV=2 67 499 1.0E-16
sp|P0AFR3|DAUA_ECO57 C4-dicarboxylic acid transporter DauA OS=Escherichia coli O157:H7 GN=dauA PE=3 SV=2 67 499 1.0E-16
sp|Q14SY0|BICA_SYNP2 Bicarbonate transporter BicA OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=bicA PE=1 SV=1 71 459 3.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008272 sulfate transport Yes
GO:0015116 sulfate transmembrane transporter activity Yes
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0072348 sulfur compound transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006820 anion transport No
GO:0005575 cellular_component No
GO:0015698 inorganic anion transport No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 77 99 22
2 103 125 22
3 130 147 17
4 162 184 22
5 191 213 22
6 243 262 19
7 274 296 22
8 339 361 22
9 370 392 22
10 407 429 22
11 431 448 17
12 463 494 31

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8516
MKIRGAFDAVTTRVFGIDAASPPALHDSLGAIDTYMEEEPTVAEWFGQLAPTWAGTAAYLVDLFPSASWIRRYNV
RWLAGDLIAGITIGLVVVPQALAYASLAQLPPAYGLYTSFTGAALYWLFGTSKDIVIGATAVGSLLVGQVVSRVQ
DAAPDTYQPEETARALSLITGAMLLGFGLLRLGWIIEFIPYIPISAFVTGASITIMSTQLPVVLGIPNIDTRQPP
YLVISSTLRGIGRTRMDAAIGLTAIVLLFAVKSFCAAMERRMPRQKRAWSYVSSLRLTFTMLLFTLVSYLVHRDT
PLKEAKFRIVGPIERGFVRAAVPMPKIELLKEILPELPAVAIILVIEHIAIAKAMGRLYNYNVDPSQETVALGAA
NLLSPFVGGYVCTGSFGASAVLSKAGARSPLAGLFSAAILVLVLYALTTVFYYIPNAALAGLIIHAVCNLIISPK
KLYGYWQLSPPELIIWVVSVVLAIFTSLETSIYVGIALSSALLVVRIARTKGDFLGRVHIQRVAASDGERLNGEG
SSRDVFLPVDRADGTNPGVKINSPHPGVFVYRLNEGFNYTNQAHHVDTLTRHIVSRTRPGAEEHVERDSDRLWND
PGPTAKTATAKAAAALPPLRAVVLDLAAVNNVDVTSVQGLMDLRSSLNRHAAPDTVAWHLANVHNRWTRRALAAA
GFGRPRTVRWGKGEREEVASYYNAAEMQAYSDDERLRQTGPEPDEESGWESTTPTPETRLTTVCAVDRPLFHLDL
LDAVACAVEEAVASAVSEAEDEPVASSRLEEEAELV
Coding >Ophio5|8516
ATGAAAATCCGAGGAGCCTTCGACGCCGTCACCACCCGCGTCTTCGGCATCGACGCTGCCAGCCCGCCAGCCCTC
CATGACTCGCTCGGCGCTATCGACACTTACATGGAAGAGGAGCCAACGGTGGCGGAATGGTTCGGTCAGCTGGCG
CCGACGTGGGCGGGCACAGCTGCCTACCTTGTCGACTTGTTCCCCTCGGCTTCATGGATAAGGCGGTATAACGTC
CGGTGGCTTGCGGGGGATTTGATCGCCGGAATCACCATCGGACTCGTCGTCGTCCCTCAGGCGCTGGCCTACGCG
TCTCTCGCCCAGCTTCCGCCCGCGTACGGCTTATACACGTCCTTTACCGGCGCCGCCTTATACTGGCTATTCGGA
ACATCCAAAGACATCGTCATCGGAGCAACAGCCGTCGGCTCTCTCCTCGTAGGCCAAGTCGTCTCGCGCGTCCAA
GATGCCGCGCCCGACACGTACCAGCCCGAGGAAACAGCGCGTGCGTTAAGTCTGATAACGGGAGCGATGCTCCTC
GGCTTCGGCCTGTTGCGTCTGGGCTGGATCATCGAGTTCATCCCGTACATACCCATCTCGGCCTTCGTCACGGGA
GCCAGCATCACCATCATGTCGACGCAGCTGCCCGTCGTTCTGGGCATTCCCAACATCGACACGCGCCAGCCGCCG
TACCTGGTCATCTCGTCGACGCTTCGGGGCATAGGCCGCACGCGTATGGATGCAGCCATCGGCTTGACGGCCATT
GTTCTGCTCTTCGCCGTCAAGAGCTTCTGCGCTGCCATGGAGAGGCGTATGCCGCGACAGAAGCGCGCCTGGTCG
TACGTTTCGTCGCTGCGGCTGACCTTTACCATGCTGCTCTTCACCCTGGTCAGTTACCTGGTTCATCGGGATACG
CCCCTGAAGGAGGCCAAGTTTCGCATCGTCGGCCCCATCGAGCGCGGTTTCGTCCGGGCGGCGGTGCCGATGCCC
AAGATTGAGCTGCTCAAGGAAATTCTCCCCGAGCTGCCGGCCGTGGCCATCATCCTCGTCATCGAGCACATCGCC
ATCGCAAAGGCCATGGGCAGGCTATACAACTACAACGTCGACCCGTCGCAGGAGACGGTGGCGCTGGGAGCGGCC
AACCTTCTAAGCCCCTTTGTAGGGGGTTACGTCTGTACCGGCTCCTTTGGTGCCTCGGCCGTGCTGTCCAAGGCC
GGTGCGAGGAGCCCGCTGGCTGGTCTCTTCAGCGCCGCTATCCTGGTCCTGGTCCTCTACGCGCTCACTACCGTC
TTCTACTACATCCCCAATGCGGCGCTGGCGGGCCTCATCATCCACGCCGTCTGCAACCTCATCATCTCGCCCAAG
AAGCTGTACGGGTATTGGCAGCTTTCACCGCCGGAGCTGATTATCTGGGTCGTCAGCGTTGTGCTGGCCATCTTT
ACGTCTCTGGAGACGTCCATCTATGTCGGCATCGCCTTGTCGTCTGCTCTGCTCGTCGTACGCATAGCCAGGACG
AAAGGCGACTTCCTGGGCCGAGTGCACATTCAGCGCGTCGCCGCCTCGGACGGGGAGCGCCTCAACGGTGAAGGC
TCATCTCGCGACGTCTTCTTACCGGTCGACCGCGCAGACGGGACCAATCCGGGCGTCAAGATCAATAGTCCTCAT
CCGGGCGTCTTCGTCTACCGCTTGAACGAGGGCTTCAACTACACCAATCAAGCACATCACGTCGACACGCTGACG
CGACACATCGTATCGCGGACGCGACCCGGGGCAGAAGAGCACGTCGAGCGAGACTCGGATCGGCTTTGGAACGAC
CCCGGACCGACGGCCAAGACGGCGACGGCCAAGGCGGCGGCGGCGCTTCCTCCCTTACGCGCCGTGGTGCTGGAC
CTCGCAGCCGTCAACAACGTCGACGTCACGTCCGTACAAGGCCTGATGGACCTGCGGAGCAGCCTCAACCGTCAC
GCGGCGCCGGACACTGTAGCCTGGCACCTGGCTAACGTACACAACCGGTGGACACGCCGGGCCCTGGCAGCCGCC
GGCTTCGGACGTCCTCGGACCGTACGCTGGGGCAAGGGCGAGCGAGAGGAAGTGGCCAGCTACTACAACGCGGCC
GAGATGCAGGCCTACAGCGATGACGAGAGGCTGCGGCAGACGGGGCCGGAGCCGGACGAGGAGAGCGGCTGGGAA
TCGACGACGCCGACGCCGGAGACGAGGTTGACGACTGTCTGTGCCGTCGACCGACCCCTGTTCCATCTCGATCTG
CTGGATGCGGTGGCGTGTGCCGTCGAGGAGGCCGTGGCTTCAGCCGTCTCCGAAGCGGAAGACGAGCCGGTGGCT
TCGAGCCGATTGGAAGAGGAGGCCGAGTTGGTG
Transcript >Ophio5|8516
ATGAAAATCCGAGGAGCCTTCGACGCCGTCACCACCCGCGTCTTCGGCATCGACGCTGCCAGCCCGCCAGCCCTC
CATGACTCGCTCGGCGCTATCGACACTTACATGGAAGAGGAGCCAACGGTGGCGGAATGGTTCGGTCAGCTGGCG
CCGACGTGGGCGGGCACAGCTGCCTACCTTGTCGACTTGTTCCCCTCGGCTTCATGGATAAGGCGGTATAACGTC
CGGTGGCTTGCGGGGGATTTGATCGCCGGAATCACCATCGGACTCGTCGTCGTCCCTCAGGCGCTGGCCTACGCG
TCTCTCGCCCAGCTTCCGCCCGCGTACGGCTTATACACGTCCTTTACCGGCGCCGCCTTATACTGGCTATTCGGA
ACATCCAAAGACATCGTCATCGGAGCAACAGCCGTCGGCTCTCTCCTCGTAGGCCAAGTCGTCTCGCGCGTCCAA
GATGCCGCGCCCGACACGTACCAGCCCGAGGAAACAGCGCGTGCGTTAAGTCTGATAACGGGAGCGATGCTCCTC
GGCTTCGGCCTGTTGCGTCTGGGCTGGATCATCGAGTTCATCCCGTACATACCCATCTCGGCCTTCGTCACGGGA
GCCAGCATCACCATCATGTCGACGCAGCTGCCCGTCGTTCTGGGCATTCCCAACATCGACACGCGCCAGCCGCCG
TACCTGGTCATCTCGTCGACGCTTCGGGGCATAGGCCGCACGCGTATGGATGCAGCCATCGGCTTGACGGCCATT
GTTCTGCTCTTCGCCGTCAAGAGCTTCTGCGCTGCCATGGAGAGGCGTATGCCGCGACAGAAGCGCGCCTGGTCG
TACGTTTCGTCGCTGCGGCTGACCTTTACCATGCTGCTCTTCACCCTGGTCAGTTACCTGGTTCATCGGGATACG
CCCCTGAAGGAGGCCAAGTTTCGCATCGTCGGCCCCATCGAGCGCGGTTTCGTCCGGGCGGCGGTGCCGATGCCC
AAGATTGAGCTGCTCAAGGAAATTCTCCCCGAGCTGCCGGCCGTGGCCATCATCCTCGTCATCGAGCACATCGCC
ATCGCAAAGGCCATGGGCAGGCTATACAACTACAACGTCGACCCGTCGCAGGAGACGGTGGCGCTGGGAGCGGCC
AACCTTCTAAGCCCCTTTGTAGGGGGTTACGTCTGTACCGGCTCCTTTGGTGCCTCGGCCGTGCTGTCCAAGGCC
GGTGCGAGGAGCCCGCTGGCTGGTCTCTTCAGCGCCGCTATCCTGGTCCTGGTCCTCTACGCGCTCACTACCGTC
TTCTACTACATCCCCAATGCGGCGCTGGCGGGCCTCATCATCCACGCCGTCTGCAACCTCATCATCTCGCCCAAG
AAGCTGTACGGGTATTGGCAGCTTTCACCGCCGGAGCTGATTATCTGGGTCGTCAGCGTTGTGCTGGCCATCTTT
ACGTCTCTGGAGACGTCCATCTATGTCGGCATCGCCTTGTCGTCTGCTCTGCTCGTCGTACGCATAGCCAGGACG
AAAGGCGACTTCCTGGGCCGAGTGCACATTCAGCGCGTCGCCGCCTCGGACGGGGAGCGCCTCAACGGTGAAGGC
TCATCTCGCGACGTCTTCTTACCGGTCGACCGCGCAGACGGGACCAATCCGGGCGTCAAGATCAATAGTCCTCAT
CCGGGCGTCTTCGTCTACCGCTTGAACGAGGGCTTCAACTACACCAATCAAGCACATCACGTCGACACGCTGACG
CGACACATCGTATCGCGGACGCGACCCGGGGCAGAAGAGCACGTCGAGCGAGACTCGGATCGGCTTTGGAACGAC
CCCGGACCGACGGCCAAGACGGCGACGGCCAAGGCGGCGGCGGCGCTTCCTCCCTTACGCGCCGTGGTGCTGGAC
CTCGCAGCCGTCAACAACGTCGACGTCACGTCCGTACAAGGCCTGATGGACCTGCGGAGCAGCCTCAACCGTCAC
GCGGCGCCGGACACTGTAGCCTGGCACCTGGCTAACGTACACAACCGGTGGACACGCCGGGCCCTGGCAGCCGCC
GGCTTCGGACGTCCTCGGACCGTACGCTGGGGCAAGGGCGAGCGAGAGGAAGTGGCCAGCTACTACAACGCGGCC
GAGATGCAGGCCTACAGCGATGACGAGAGGCTGCGGCAGACGGGGCCGGAGCCGGACGAGGAGAGCGGCTGGGAA
TCGACGACGCCGACGCCGGAGACGAGGTTGACGACTGTCTGTGCCGTCGACCGACCCCTGTTCCATCTCGATCTG
CTGGATGCGGTGGCGTGTGCCGTCGAGGAGGCCGTGGCTTCAGCCGTCTCCGAAGCGGAAGACGAGCCGGTGGCT
TCGAGCCGATTGGAAGAGGAGGCCGAGTTGGTGTAA
Gene >Ophio5|8516
ATGAAAATCCGAGGAGCCTTCGACGCCGTCACCACCCGCGTCTTCGGCATCGACGCTGCCAGCCCGCCAGCCCTC
CATGACTCGCTCGGCGCTATCGACACTTACATGGAAGAGGAGCCAACGGTGGCGGAATGGTTCGGTCAGCTGGCG
CCGACGTGGGCGGGCACAGCTGCCTACCTTGTCGACTTGTTCCCCTCGGCTTCATGGATAAGGCGGTATAACGTC
CGGTGGCTTGCGGGGGATTTGATCGCCGGTGCGTGGTGTGGAAAACTAGTAATATGGAAGGGTTCGATCGCTGAC
GGGGTCTTGCGCAGGAATCACCATCGGACTCGTCGTCGTCCCTCAGGCGCTGGCCTACGCGTCTCTCGCCCAGCT
TCCGCCCGCGTACGGCTTATACACGTCCTTTACCGGCGCCGCCTTATACTGGCTATTCGGAACATCCAAAGACAT
CGTCATCGGAGTCAGTTTTTTTTTTGTTTCCCGAGACAGCCCGAAAAGTTGCTGACTTTTGCCCGCCCCCCCCTT
AGGCAACAGCCGTCGGCTCTCTCCTCGTAGGCCAAGTCGTCTCGCGCGTCCAAGATGCCGCGCCCGACACGTACC
AGCCCGAGGAAACAGCGCGTGCGTTAAGTCTGATAACGGGAGCGATGCTCCTCGGCTTCGGCCTGTTGCGTCTGG
GCTGGATCATCGAGTTCATCCCGTACATACCCATCTCGGCCTTCGTCACGGGAGCCAGCATCACCATCATGTCGA
CGCAGCTGCCCGTCGTTCTGGGCATTCCCAACATCGACACGCGCCAGCCGCCGTACCTGGTCATCTCGTCGACGC
TTCGGGGCATAGGCCGCACGCGTATGGATGCAGCCATCGGCTTGACGGCCATTGTTCTGCTCTTCGCCGTCAAGA
GCTTCTGCGCTGCCATGGAGAGGCGTATGCCGCGACAGAAGCGCGCCTGGTCGTACGTTTCGTCGCTGCGGCTGA
CCTTTACCATGCTGCTCTTCACCCTGGTCAGTTACCTGGTTCATCGGGATACGCCCCTGAAGGAGGCCAAGTTTC
GCATCGTCGGCCCCATCGAGCGCGGTTTCGTCCGGGCGGCGGTGCCGATGCCCAAGATTGAGCTGCTCAAGGAAA
TTCTCCCCGAGCTGCCGGCCGTGGCCATCATCCTCGTCATCGAGCACATCGCCATCGCAAAGGCCATGGGCAGGC
TATACAACTACAACGTCGACCCGTCGCAGGAGACGGTGGCGCTGGGAGCGGCCAACCTTCTAAGCCCCTTTGTAG
GGGGTTACGTCTGTACCGGCTCCTTTGGTGCCTCGGCCGTGCTGTCCAAGGCCGGTGCGAGGAGCCCGCTGGCTG
GTCTCTTCAGCGCCGCTATCCTGGTCCTGGTCCTCTACGCGCTCACTACCGTCTTCTACTACATCCCCAATGCGG
CGCTGGCGGGCCTCATCATCCACGCCGTCTGCAACCTCATCATCTCGCCCAAGAAGCTGTACGGGTATTGGCAGC
TTTCACCGCCGGAGCTGATTATCTGGGTCGTCAGCGTTGTGCTGGCCATCTTTACGTCTCTGGAGACGTCCATCT
ATGTCGGCATCGCCTTGTCGTCTGCTCTGCTCGTCGTACGCATAGCCAGGACGAAAGGCGACTTCCTGGGCCGAG
TGCACATTCAGCGCGTCGCCGCCTCGGACGGGGAGCGCCTCAACGGTGAAGGCTCATCTCGCGACGTCTTCTTAC
CGGTCGACCGCGCAGACGGGACCAATCCGGGCGTCAAGATCAATAGTCCTCATCCGGGCGTCTTCGTCTACCGCT
TGAACGAGGGCTTCAACTACACCAATCAAGCACATCACGTCGACACGCTGACGCGACACATCGTATCGCGGACGC
GACCCGGGGCAGAAGAGCACGTCGAGCGAGACTCGGATCGGCTTTGGAACGACCCCGGACCGACGGCCAAGACGG
CGACGGCCAAGGCGGCGGCGGCGCTTCCTCCCTTACGCGCCGTGGTGCTGGACCTCGCAGCCGTCAACAACGTCG
ACGTCACGTCCGTACAAGGCCTGATGGACCTGCGGAGCAGCCTCAACCGTCACGCGGCGCCGGACACTGTAGCCT
GGCACCTGGCTAACGTACACAACCGGTGGACACGCCGGGCCCTGGCAGCCGCCGGCTTCGGACGTCCTCGGACCG
TACGCTGGGGCAAGGGCGAGCGAGAGGAAGTGGCCAGCTACTACAACGCGGCCGAGATGCAGGCCTACAGCGATG
ACGAGAGGCTGCGGCAGACGGGGCCGGAGCCGGACGAGGAGAGCGGCTGGGAATCGACGACGCCGACGCCGGAGA
CGAGGTTGACGACTGTCTGTGCCGTCGACCGACCCCTGTTCCATCTCGATCTGCTGGATGCGGTGGCGTGTGCCG
TCGAGGAGGCCGTGGCTTCAGCCGTCTCCGAAGCGGAAGACGAGCCGGTGGCTTCGAGCCGATTGGAAGAGGAGG
CCGAGTTGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail