Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8514
Gene name
Locationscaffold_96:30751..32255
Strand-
Gene length (bp)1504
Transcript length (bp)1455
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05291 Bystin Bystin 2.6E-131 156 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60071|YBB9_SCHPO Uncharacterized protein C13G1.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.09 PE=1 SV=1 7 468 8.0E-105
sp|A9UNU6|BYST_MONBE Bystin OS=Monosiga brevicollis GN=bysl PE=3 SV=1 15 468 8.0E-100
sp|Q80WL2|BYST_RAT Bystin OS=Rattus norvegicus GN=Bysl PE=1 SV=3 1 457 2.0E-97
sp|Q13895|BYST_HUMAN Bystin OS=Homo sapiens GN=BYSL PE=1 SV=3 1 457 6.0E-97
sp|Q5E9N0|BYST_BOVIN Bystin OS=Bos taurus GN=BYSL PE=2 SV=1 1 457 4.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60071|YBB9_SCHPO Uncharacterized protein C13G1.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.09 PE=1 SV=1 7 468 8.0E-105
sp|A9UNU6|BYST_MONBE Bystin OS=Monosiga brevicollis GN=bysl PE=3 SV=1 15 468 8.0E-100
sp|Q80WL2|BYST_RAT Bystin OS=Rattus norvegicus GN=Bysl PE=1 SV=3 1 457 2.0E-97
sp|Q13895|BYST_HUMAN Bystin OS=Homo sapiens GN=BYSL PE=1 SV=3 1 457 6.0E-97
sp|Q5E9N0|BYST_BOVIN Bystin OS=Bos taurus GN=BYSL PE=2 SV=1 1 457 4.0E-96
sp|P38333|ENP1_YEAST Essential nuclear protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENP1 PE=1 SV=1 1 483 9.0E-94
sp|P51406|BYS_DROME Bystin OS=Drosophila melanogaster GN=bys PE=1 SV=2 24 477 1.0E-92
sp|O54825|BYST_MOUSE Bystin OS=Mus musculus GN=Bysl PE=1 SV=3 1 457 2.0E-91
sp|A7S7F2|BYST_NEMVE Bystin OS=Nematostella vectensis GN=bysl PE=3 SV=1 159 465 2.0E-89
sp|Q20932|BYN1_CAEEL Cell adhesion protein byn-1 OS=Caenorhabditis elegans GN=byn-1 PE=3 SV=2 29 457 3.0E-86
sp|Q54IS0|BYST_DICDI Bystin OS=Dictyostelium discoideum GN=bysl PE=3 SV=1 117 464 7.0E-86
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8514
MPKTSAPVVDRQARRHNPLEDDILTSGLLRSKPNKKRPRGQDADEGFVDSRASRDILRIGRELVDEEAAERAATT
TEPIVDSFGYDSRFDEAEADADAAHAYGDDDDWGDEEEAVEEIEIDPQDLETYSKFMPDKNEDDLLKHGWDRRPT
GNEQGESVNLADLILEKIAAYEASEARKEAGLPAEEHQLPPRVIEAYTKVGQILSRYKSGPLPKPFKILPTVPHW
EDILEITKPESWTPNACYQATRIFVSHKPAVVQRFLEMVVLEKVREDIYENKKLNVHLFNSLKKALYKPAAFFKG
FLFPLVGSGTCTLREAHIISAVLARISIPVLHSAAALKGLCDIAAQEASHGTEGGGATNIFIKTLLEKKYALPYQ
VIDALVFHFLRFRSVDPAGVKEGEPSTEGDARTRLPVIWHQGLLAFAQRYKGDITEDQREALLDLLLSHGHSAIG
PEVRRELLVGRGRGVPLEPQKVAFDGDDTMVIDS
Coding >Ophio5|8514
ATGCCCAAAACCTCGGCTCCCGTTGTCGATCGCCAGGCTCGACGCCACAACCCACTCGAAGATGACATACTCACC
AGTGGCCTCCTCCGGAGCAAGCCGAACAAGAAGCGGCCCCGCGGCCAGGATGCGGATGAGGGCTTCGTCGACTCC
AGGGCGTCTCGGGACATCCTGCGCATAGGCCGCGAGCTGGTGGACGAGGAGGCCGCTGAGAGAGCGGCTACGACG
ACGGAACCTATCGTCGACAGCTTTGGGTACGACTCCCGATTCGACGAAGCAGAAGCCGACGCGGACGCCGCCCAC
GCCTACGGAGACGACGACGACTGGGGCGACGAGGAGGAAGCCGTGGAGGAGATCGAGATCGATCCCCAAGACCTC
GAGACTTACAGCAAATTCATGCCCGACAAAAATGAGGATGATCTGCTCAAGCATGGCTGGGACCGCCGCCCTACA
GGCAACGAGCAGGGCGAGAGCGTCAACTTGGCAGACCTTATCCTGGAGAAGATTGCAGCCTACGAGGCCTCCGAG
GCCAGGAAGGAGGCCGGTCTGCCCGCGGAAGAACATCAATTACCACCGCGGGTCATCGAGGCCTACACCAAAGTC
GGCCAGATCCTGTCCCGGTACAAGTCGGGGCCTCTGCCCAAGCCCTTCAAGATTCTTCCCACCGTCCCCCACTGG
GAGGACATACTCGAGATCACCAAGCCAGAGAGCTGGACGCCCAATGCCTGCTACCAGGCCACTCGCATCTTTGTC
TCCCACAAGCCCGCCGTCGTCCAACGGTTCCTTGAGATGGTCGTGCTGGAGAAGGTTCGCGAGGACATTTACGAG
AACAAGAAGCTCAACGTCCACCTCTTCAATTCACTAAAAAAGGCCCTCTACAAGCCTGCGGCCTTTTTCAAGGGC
TTCCTCTTTCCCCTCGTCGGCAGCGGCACCTGCACGCTGAGAGAGGCGCACATCATCTCGGCCGTCCTGGCCAGG
ATTTCCATCCCCGTCTTGCACTCGGCCGCAGCCCTGAAGGGTCTGTGCGACATTGCCGCCCAAGAAGCCTCTCAC
GGCACCGAGGGCGGCGGCGCCACCAACATCTTCATCAAGACACTCCTAGAGAAGAAGTACGCCCTGCCGTATCAG
GTCATTGACGCGCTCGTCTTCCACTTCCTGCGCTTCCGAAGCGTCGACCCTGCCGGCGTCAAGGAGGGTGAGCCT
TCAACCGAGGGCGACGCCAGGACCAGGCTGCCCGTCATCTGGCACCAAGGCCTACTGGCCTTTGCGCAGAGGTAC
AAGGGGGACATTACCGAGGATCAGCGCGAGGCCCTGCTGGATCTCCTCTTGAGCCACGGGCACTCGGCTATCGGG
CCAGAGGTGCGGCGAGAGCTGCTGGTCGGTAGGGGGCGAGGCGTTCCCTTGGAGCCGCAGAAAGTGGCATTTGAT
GGCGACGACACTATGGTCATTGACTCG
Transcript >Ophio5|8514
ATGCCCAAAACCTCGGCTCCCGTTGTCGATCGCCAGGCTCGACGCCACAACCCACTCGAAGATGACATACTCACC
AGTGGCCTCCTCCGGAGCAAGCCGAACAAGAAGCGGCCCCGCGGCCAGGATGCGGATGAGGGCTTCGTCGACTCC
AGGGCGTCTCGGGACATCCTGCGCATAGGCCGCGAGCTGGTGGACGAGGAGGCCGCTGAGAGAGCGGCTACGACG
ACGGAACCTATCGTCGACAGCTTTGGGTACGACTCCCGATTCGACGAAGCAGAAGCCGACGCGGACGCCGCCCAC
GCCTACGGAGACGACGACGACTGGGGCGACGAGGAGGAAGCCGTGGAGGAGATCGAGATCGATCCCCAAGACCTC
GAGACTTACAGCAAATTCATGCCCGACAAAAATGAGGATGATCTGCTCAAGCATGGCTGGGACCGCCGCCCTACA
GGCAACGAGCAGGGCGAGAGCGTCAACTTGGCAGACCTTATCCTGGAGAAGATTGCAGCCTACGAGGCCTCCGAG
GCCAGGAAGGAGGCCGGTCTGCCCGCGGAAGAACATCAATTACCACCGCGGGTCATCGAGGCCTACACCAAAGTC
GGCCAGATCCTGTCCCGGTACAAGTCGGGGCCTCTGCCCAAGCCCTTCAAGATTCTTCCCACCGTCCCCCACTGG
GAGGACATACTCGAGATCACCAAGCCAGAGAGCTGGACGCCCAATGCCTGCTACCAGGCCACTCGCATCTTTGTC
TCCCACAAGCCCGCCGTCGTCCAACGGTTCCTTGAGATGGTCGTGCTGGAGAAGGTTCGCGAGGACATTTACGAG
AACAAGAAGCTCAACGTCCACCTCTTCAATTCACTAAAAAAGGCCCTCTACAAGCCTGCGGCCTTTTTCAAGGGC
TTCCTCTTTCCCCTCGTCGGCAGCGGCACCTGCACGCTGAGAGAGGCGCACATCATCTCGGCCGTCCTGGCCAGG
ATTTCCATCCCCGTCTTGCACTCGGCCGCAGCCCTGAAGGGTCTGTGCGACATTGCCGCCCAAGAAGCCTCTCAC
GGCACCGAGGGCGGCGGCGCCACCAACATCTTCATCAAGACACTCCTAGAGAAGAAGTACGCCCTGCCGTATCAG
GTCATTGACGCGCTCGTCTTCCACTTCCTGCGCTTCCGAAGCGTCGACCCTGCCGGCGTCAAGGAGGGTGAGCCT
TCAACCGAGGGCGACGCCAGGACCAGGCTGCCCGTCATCTGGCACCAAGGCCTACTGGCCTTTGCGCAGAGGTAC
AAGGGGGACATTACCGAGGATCAGCGCGAGGCCCTGCTGGATCTCCTCTTGAGCCACGGGCACTCGGCTATCGGG
CCAGAGGTGCGGCGAGAGCTGCTGGTCGGTAGGGGGCGAGGCGTTCCCTTGGAGCCGCAGAAAGTGGCATTTGAT
GGCGACGACACTATGGTCATTGACTCGTAA
Gene >Ophio5|8514
ATGCCCAAAACCTCGGCTCCCGTTGTCGATCGCCAGGCTCGACGCCACAACCCACTCGAAGATGACATACTCACC
AGTGGCCTCCTCCGGAGCAAGCCGAACAAGAAGCGGCCCCGCGGCCAGGATGCGGATGAGGGCTTCGTCGACTCC
AGGGCGTCTCGGGACATCCTGCGCATAGGCCGCGAGCTGGTGGACGAGGAGGCCGCTGAGAGAGCGGCTACGACG
ACGGAACCTATCGTCGACAGCTTTGGGTACGACTCCCGATTCGACGAAGCAGAAGCCGACGCGGACGCCGCCCAC
GCCTACGGAGACGACGACGACTGGGGCGACGAGGAGGAAGCCGTGGAGGAGATCGAGATCGATCCCCAAGACCTC
GAGACTTACAGCAAATTCATGCCCGACAAAAATGAGGATGATCTGCTCAAGCATGGCTGGGACCGCCGCCCTACA
GGCAACGAGCAGGGCGAGAGCGTCAACTTGGCAGACCTTATCCTGGAGAAGATTGCAGCCTACGAGGCCTCCGAG
GCCAGGAAGGAGGCCGGTCTGCCCGCGGAAGAACATCAATTACCACCGCGGGTCATCGAGGCCTACACCAAGTGA
GCGGCCCGGGAGCTCGTTGCCGCGCTGTTGCTGACACTTGCCCAGAGTCGGCCAGATCCTGTCCCGGTACAAGTC
GGGGCCTCTGCCCAAGCCCTTCAAGATTCTTCCCACCGTCCCCCACTGGGAGGACATACTCGAGATCACCAAGCC
AGAGAGCTGGACGCCCAATGCCTGCTACCAGGCCACTCGCATCTTTGTCTCCCACAAGCCCGCCGTCGTCCAACG
GTTCCTTGAGATGGTCGTGCTGGAGAAGGTTCGCGAGGACATTTACGAGAACAAGAAGCTCAACGTCCACCTCTT
CAATTCACTAAAAAAGGCCCTCTACAAGCCTGCGGCCTTTTTCAAGGGCTTCCTCTTTCCCCTCGTCGGCAGCGG
CACCTGCACGCTGAGAGAGGCGCACATCATCTCGGCCGTCCTGGCCAGGATTTCCATCCCCGTCTTGCACTCGGC
CGCAGCCCTGAAGGGTCTGTGCGACATTGCCGCCCAAGAAGCCTCTCACGGCACCGAGGGCGGCGGCGCCACCAA
CATCTTCATCAAGACACTCCTAGAGAAGAAGTACGCCCTGCCGTATCAGGTCATTGACGCGCTCGTCTTCCACTT
CCTGCGCTTCCGAAGCGTCGACCCTGCCGGCGTCAAGGAGGGTGAGCCTTCAACCGAGGGCGACGCCAGGACCAG
GCTGCCCGTCATCTGGCACCAAGGCCTACTGGCCTTTGCGCAGAGGTACAAGGGGGACATTACCGAGGATCAGCG
CGAGGCCCTGCTGGATCTCCTCTTGAGCCACGGGCACTCGGCTATCGGGCCAGAGGTGCGGCGAGAGCTGCTGGT
CGGTAGGGGGCGAGGCGTTCCCTTGGAGCCGCAGAAAGTGGCATTTGATGGCGACGACACTATGGTCATTGACTC
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail