Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8513
Gene name
Locationscaffold_96:29697..30733
Strand-
Gene length (bp)1036
Transcript length (bp)681
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 14.36 4.57 24.14
CcL In ants, during behavior modification 29.51 11.40 47.61
CcD In ants, recently dead 20.63 7.47 33.79

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.020657 yes
SC16a CcD 0.279674 no
CcL CcD 0.268557 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8513
MMSGVLSELWVFGALVWYSQGASAPAPTCAYQNGSLEPAGRPHHIPIGRMVRHHRVAVSTASPYLWPEAEARPLR
GTVLSGWLARRAMQSGAVGSSEPSYFDVFPGFKPTLPILDETMPTSTAKRHDGDDDDDDDDDDDDDYDYDYDYDY
DDEKEENDVLSSEKIVQSGVDDGATGLAWRRMMPDDGAVTDTSSPSSGIKTATAKTTAHHHAHNIDPPRPARDEF
E
Coding >Ophio5|8513
ATGATGAGCGGTGTCCTATCTGAACTTTGGGTGTTTGGCGCGTTGGTTTGGTACAGTCAGGGAGCTTCAGCGCCT
GCCCCGACCTGTGCTTACCAGAACGGTTCTCTCGAGCCTGCCGGGAGGCCGCATCACATCCCTATAGGCCGCATG
GTCCGACATCATCGAGTCGCAGTTTCTACTGCGTCGCCCTACCTGTGGCCTGAAGCTGAGGCCAGGCCGCTGCGA
GGCACCGTCTTGTCAGGCTGGCTGGCGCGCAGAGCCATGCAGTCCGGCGCCGTGGGCTCCAGCGAGCCCAGCTAC
TTCGATGTCTTTCCCGGCTTCAAGCCGACTCTGCCAATCCTCGACGAAACGATGCCGACGTCCACGGCTAAGCGC
CACGACGGCGATGACGACGACGACGACGACGACGACGACGACGACGACTACGACTACGACTACGACTACGACTAC
GACGACGAGAAGGAAGAGAATGATGTTCTCAGCAGTGAAAAGATCGTTCAAAGCGGTGTCGACGATGGAGCTACC
GGCCTCGCATGGCGTCGGATGATGCCCGATGACGGCGCCGTGACGGACACATCCTCACCCTCGTCCGGCATCAAG
ACAGCAACAGCAAAGACAACAGCTCACCACCATGCCCACAACATCGACCCTCCCCGCCCGGCCCGCGACGAATTC
GAA
Transcript >Ophio5|8513
ATGATGAGCGGTGTCCTATCTGAACTTTGGGTGTTTGGCGCGTTGGTTTGGTACAGTCAGGGAGCTTCAGCGCCT
GCCCCGACCTGTGCTTACCAGAACGGTTCTCTCGAGCCTGCCGGGAGGCCGCATCACATCCCTATAGGCCGCATG
GTCCGACATCATCGAGTCGCAGTTTCTACTGCGTCGCCCTACCTGTGGCCTGAAGCTGAGGCCAGGCCGCTGCGA
GGCACCGTCTTGTCAGGCTGGCTGGCGCGCAGAGCCATGCAGTCCGGCGCCGTGGGCTCCAGCGAGCCCAGCTAC
TTCGATGTCTTTCCCGGCTTCAAGCCGACTCTGCCAATCCTCGACGAAACGATGCCGACGTCCACGGCTAAGCGC
CACGACGGCGATGACGACGACGACGACGACGACGACGACGACGACGACTACGACTACGACTACGACTACGACTAC
GACGACGAGAAGGAAGAGAATGATGTTCTCAGCAGTGAAAAGATCGTTCAAAGCGGTGTCGACGATGGAGCTACC
GGCCTCGCATGGCGTCGGATGATGCCCGATGACGGCGCCGTGACGGACACATCCTCACCCTCGTCCGGCATCAAG
ACAGCAACAGCAAAGACAACAGCTCACCACCATGCCCACAACATCGACCCTCCCCGCCCGGCCCGCGACGAATTC
GAATAG
Gene >Ophio5|8513
ATGATGAGCGGTGTCCTATCTGAACTTTGGGTGTTTGGCGCGTTGGTTTGGTACAGTCAGGGGTAAGGCCCCCCT
TTTCCCCCCGACATGGCACGGCGACGACTGGGACCGCCTAGTGGGCGGCTATTACTGTCTGCGATACGAGAAGAA
AAAGATGAAAGCGTCGATGCGAAATGAAAGAAGTTGTGTACAGTCTGATCGAAACATGGCCCAAGTATAGAGCTT
CAGCGCCTGCCCCGACCTGTGCTTACCAGAACGGTTCTCTCGAGCCTGCCGGGGTCTTCGGAGAGTAAGGAGGCC
AGGAGCAAGTCCTCATGGCTGCTCACCCCCGTGTCTAAGCTGGAAGACACACTCGCGGGCGCCCAACGATTTAAC
GAAAAAAACGCGCATCCTACCTATGCAACCTATGCACATCTCAGAGGCCGCATCACATCCCTATAGGCCGCATGG
TCCGACATCATCGAGTCGCAGTTTCTACTGCGTCGCCCTACCTGTGGCCTGAAGCTGAGGCCAGGCCGCTGCGAG
GCACCGTCTTGTCAGGCTGGCTGGCGCGCAGAGCCATGCAGTCCGGCGCCGTGGGCTCCAGCGAGCCCAGGTGCG
TGCATTCGATTTGGTCTCAGCAGACGGCGGCTCATGCGCCGCTTACCGCAGCTACTTCGATGTCTTTCCCGGCTT
CAAGCCGACTCTGCCAATCCTCGACGAAACGATGCCGACGTCCACGGCTAAGCGCCACGACGGCGATGACGACGA
CGACGACGACGACGACGACGACGACGACTACGACTACGACTACGACTACGACTACGACGACGAGAAGGAAGAGAA
TGATGTTCTCAGCAGTGAAAAGATCGTTCAAAGCGGTGTCGACGATGGAGCTACCGGCCTCGCATGGCGTCGGAT
GATGCCCGATGACGGCGCCGTGACGGACACATCCTCACCCTCGTCCGGCATCAAGACAGCAACAGCAAAGACAAC
AGCTCACCACCATGCCCACAACATCGACCCTCCCCGCCCGGCCCGCGACGAATTCGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail