Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|851
Gene name
Locationscaffold_125:10954..12583
Strand-
Gene length (bp)1629
Transcript length (bp)1575
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10329 DUF2417 Region of unknown function (DUF2417) 1.9E-80 36 263

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13912|YDW6_SCHPO Uncharacterized protein C23C11.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C11.06c PE=4 SV=1 26 524 8.0E-84
sp|P53925|YNL5_YEAST Uncharacterized vacuolar membrane protein YNL115C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL115C PE=1 SV=1 98 522 2.0E-31
sp|A6ZRW8|YNL5_YEAS7 Uncharacterized vacuolar membrane protein SCY_4679 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_4679 PE=3 SV=1 98 522 2.0E-31

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 109 128 19
3 135 157 22
4 162 181 19
5 210 232 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|851
MPLFSKANKNDADGDNDSHPRSQPPAHDGEQPPADERTRLLPARGDAGRGMLAPDDPAVTPYNLWSIRILRYLTL
FVTALTLAWWLLLLVSAFATPPGLNTRGSSFSAYSFASLALANMLFTLVFFGVPSKSVRILAIITALMLFLDLVL
LASVQQTRHEEGWVGLVSATWALLMSIWALLADRAVKWGKEEEEERLTGRAETRRTLSEWLAVLLSTIAYVVMAV
AVLLMTLTIILRALDAGIAPPGKLYEVDGGKYRVHVYCHGNATDRPTVLFEGGEKPVEHGLWQLADKAVRHRSFS
RFCFIDRPGYGWSDTAPSPLSAGFAVDVLSEALAAADEKGPWVLASAGIGSIYSRVFSSRHAHEVRGLVLIDPLH
EDLLDRVASPGRGFLLWLRGVISPLGLDRLSGAIFRGRTSRDRIYGRAASQGSKLIFARLQENLVANSFTRRDVQ
GSRRIQDQNTALVVISSGVEMKRSERWAEKQRDLTKLTDNLKHWDVVDEAPHEVWESSKGSKRIEERLRQLVHA
Coding >Ophio5|851
ATGCCGCTTTTCTCAAAGGCAAACAAGAACGACGCCGACGGTGACAATGACAGCCATCCTCGGTCTCAACCGCCG
GCTCACGATGGCGAACAGCCACCGGCCGACGAGCGCACTCGACTACTACCTGCTCGCGGTGATGCCGGCCGAGGC
ATGCTTGCCCCCGACGATCCCGCAGTCACTCCTTACAACCTCTGGAGCATCCGTATCCTTCGCTACTTGACGCTC
TTCGTAACCGCACTGACCCTCGCCTGGTGGCTTCTGCTGCTCGTGTCAGCTTTTGCCACGCCTCCGGGCCTGAAT
ACTCGCGGAAGCAGCTTCTCGGCCTACAGCTTTGCCAGCTTGGCCCTGGCCAATATGCTCTTTACCCTCGTCTTC
TTCGGCGTGCCGTCCAAGTCGGTGCGCATCCTGGCCATCATCACGGCCTTGATGCTTTTCCTCGATCTGGTGCTG
CTTGCCAGCGTGCAGCAAACGCGCCACGAGGAGGGCTGGGTCGGTCTTGTCAGCGCCACCTGGGCCCTACTGATG
AGCATTTGGGCTCTGCTCGCCGACCGGGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGTTGACGGGCCGA
GCCGAGACGCGACGCACGCTATCTGAGTGGCTGGCGGTGCTATTGTCCACCATCGCCTACGTCGTCATGGCCGTC
GCTGTCCTGCTCATGACGCTGACCATCATCTTGCGTGCCCTCGACGCCGGCATCGCACCCCCCGGCAAGCTGTAC
GAGGTAGACGGTGGCAAGTATCGCGTCCACGTTTACTGCCACGGCAACGCCACCGATCGGCCGACGGTGCTCTTC
GAGGGCGGCGAGAAGCCCGTCGAGCATGGCCTGTGGCAGCTGGCCGACAAGGCCGTGCGCCACCGGTCCTTTTCG
CGCTTCTGCTTCATCGACCGCCCGGGCTACGGCTGGTCGGACACGGCGCCGTCGCCGCTCTCGGCCGGTTTCGCT
GTCGATGTGCTGAGCGAGGCGCTGGCGGCGGCGGATGAGAAAGGCCCGTGGGTACTGGCCAGCGCAGGCATCGGG
TCCATCTACTCGCGTGTTTTCTCGTCCCGCCACGCGCACGAGGTTCGCGGACTCGTCCTCATCGACCCGCTGCAC
GAGGACCTGCTCGACCGGGTGGCATCACCGGGCCGGGGGTTTCTGCTCTGGCTGCGCGGCGTCATCTCACCGCTG
GGACTTGACCGGCTGTCGGGGGCCATCTTCAGGGGACGGACGAGTCGGGATCGCATCTACGGACGGGCGGCGTCG
CAGGGCAGCAAGCTCATCTTCGCCCGGCTGCAGGAGAACCTGGTGGCCAACTCGTTTACGCGACGCGACGTACAG
GGCAGCCGCCGGATCCAGGACCAAAACACGGCGCTCGTCGTCATCAGCTCGGGCGTCGAGATGAAGCGCAGCGAG
CGCTGGGCTGAGAAGCAGCGTGACCTGACGAAGCTGACGGACAATCTCAAGCACTGGGACGTGGTCGACGAGGCG
CCTCACGAGGTGTGGGAGTCGTCCAAGGGTAGCAAGCGAATCGAGGAGCGTCTCCGACAGCTAGTACACGCG
Transcript >Ophio5|851
ATGCCGCTTTTCTCAAAGGCAAACAAGAACGACGCCGACGGTGACAATGACAGCCATCCTCGGTCTCAACCGCCG
GCTCACGATGGCGAACAGCCACCGGCCGACGAGCGCACTCGACTACTACCTGCTCGCGGTGATGCCGGCCGAGGC
ATGCTTGCCCCCGACGATCCCGCAGTCACTCCTTACAACCTCTGGAGCATCCGTATCCTTCGCTACTTGACGCTC
TTCGTAACCGCACTGACCCTCGCCTGGTGGCTTCTGCTGCTCGTGTCAGCTTTTGCCACGCCTCCGGGCCTGAAT
ACTCGCGGAAGCAGCTTCTCGGCCTACAGCTTTGCCAGCTTGGCCCTGGCCAATATGCTCTTTACCCTCGTCTTC
TTCGGCGTGCCGTCCAAGTCGGTGCGCATCCTGGCCATCATCACGGCCTTGATGCTTTTCCTCGATCTGGTGCTG
CTTGCCAGCGTGCAGCAAACGCGCCACGAGGAGGGCTGGGTCGGTCTTGTCAGCGCCACCTGGGCCCTACTGATG
AGCATTTGGGCTCTGCTCGCCGACCGGGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGTTGACGGGCCGA
GCCGAGACGCGACGCACGCTATCTGAGTGGCTGGCGGTGCTATTGTCCACCATCGCCTACGTCGTCATGGCCGTC
GCTGTCCTGCTCATGACGCTGACCATCATCTTGCGTGCCCTCGACGCCGGCATCGCACCCCCCGGCAAGCTGTAC
GAGGTAGACGGTGGCAAGTATCGCGTCCACGTTTACTGCCACGGCAACGCCACCGATCGGCCGACGGTGCTCTTC
GAGGGCGGCGAGAAGCCCGTCGAGCATGGCCTGTGGCAGCTGGCCGACAAGGCCGTGCGCCACCGGTCCTTTTCG
CGCTTCTGCTTCATCGACCGCCCGGGCTACGGCTGGTCGGACACGGCGCCGTCGCCGCTCTCGGCCGGTTTCGCT
GTCGATGTGCTGAGCGAGGCGCTGGCGGCGGCGGATGAGAAAGGCCCGTGGGTACTGGCCAGCGCAGGCATCGGG
TCCATCTACTCGCGTGTTTTCTCGTCCCGCCACGCGCACGAGGTTCGCGGACTCGTCCTCATCGACCCGCTGCAC
GAGGACCTGCTCGACCGGGTGGCATCACCGGGCCGGGGGTTTCTGCTCTGGCTGCGCGGCGTCATCTCACCGCTG
GGACTTGACCGGCTGTCGGGGGCCATCTTCAGGGGACGGACGAGTCGGGATCGCATCTACGGACGGGCGGCGTCG
CAGGGCAGCAAGCTCATCTTCGCCCGGCTGCAGGAGAACCTGGTGGCCAACTCGTTTACGCGACGCGACGTACAG
GGCAGCCGCCGGATCCAGGACCAAAACACGGCGCTCGTCGTCATCAGCTCGGGCGTCGAGATGAAGCGCAGCGAG
CGCTGGGCTGAGAAGCAGCGTGACCTGACGAAGCTGACGGACAATCTCAAGCACTGGGACGTGGTCGACGAGGCG
CCTCACGAGGTGTGGGAGTCGTCCAAGGGTAGCAAGCGAATCGAGGAGCGTCTCCGACAGCTAGTACACGCGTGA
Gene >Ophio5|851
ATGCCGCTTTTCTCAAAGGCAAACAAGAACGACGCCGACGGTGACAATGACAGCCATCCTCGGTCTCAACCGCCG
GCTCACGATGGCGAACAGCCACCGGCCGACGAGCGCACTCGACTACTACCTGCTCGCGGTGATGCCGGCCGAGGC
ATGCTTGCCCCCGACGATCCCGCAGTCACTCCTTACAACCTCTGGAGCATCCGTATCCTTCGCTACTTGACGCTC
TTCGTAACCGCACTGACCCTCGCCTGGTGGCTTCTGCTGCTCGTGTCAGCTTTTGCCACGCCTCCGGGCCTGAAT
ACTCGCGGAAGCAGCTTCTCGGCCTACAGCTTTGCCAGCTTGGCCCTGGCCAATATGCTCTTTACCCTCGTCTTC
TTCGGCGTGCCGTCCAAGTCGGTGCGCATCCTGGCCATCATCACGGCCGTGAGTCGCTCCCACCTCACCGCGAGG
TCAATCTTGAAACTGACATGGTCGCAGTTGATGCTTTTCCTCGATCTGGTGCTGCTTGCCAGCGTGCAGCAAACG
CGCCACGAGGAGGGCTGGGTCGGTCTTGTCAGCGCCACCTGGGCCCTACTGATGAGCATTTGGGCTCTGCTCGCC
GACCGGGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGTTGACGGGCCGAGCCGAGACGCGACGCACGCTA
TCTGAGTGGCTGGCGGTGCTATTGTCCACCATCGCCTACGTCGTCATGGCCGTCGCTGTCCTGCTCATGACGCTG
ACCATCATCTTGCGTGCCCTCGACGCCGGCATCGCACCCCCCGGCAAGCTGTACGAGGTAGACGGTGGCAAGTAT
CGCGTCCACGTTTACTGCCACGGCAACGCCACCGATCGGCCGACGGTGCTCTTCGAGGGCGGCGAGAAGCCCGTC
GAGCATGGCCTGTGGCAGCTGGCCGACAAGGCCGTGCGCCACCGGTCCTTTTCGCGCTTCTGCTTCATCGACCGC
CCGGGCTACGGCTGGTCGGACACGGCGCCGTCGCCGCTCTCGGCCGGTTTCGCTGTCGATGTGCTGAGCGAGGCG
CTGGCGGCGGCGGATGAGAAAGGCCCGTGGGTACTGGCCAGCGCAGGCATCGGGTCCATCTACTCGCGTGTTTTC
TCGTCCCGCCACGCGCACGAGGTTCGCGGACTCGTCCTCATCGACCCGCTGCACGAGGACCTGCTCGACCGGGTG
GCATCACCGGGCCGGGGGTTTCTGCTCTGGCTGCGCGGCGTCATCTCACCGCTGGGACTTGACCGGCTGTCGGGG
GCCATCTTCAGGGGACGGACGAGTCGGGATCGCATCTACGGACGGGCGGCGTCGCAGGGCAGCAAGCTCATCTTC
GCCCGGCTGCAGGAGAACCTGGTGGCCAACTCGTTTACGCGACGCGACGTACAGGGCAGCCGCCGGATCCAGGAC
CAAAACACGGCGCTCGTCGTCATCAGCTCGGGCGTCGAGATGAAGCGCAGCGAGCGCTGGGCTGAGAAGCAGCGT
GACCTGACGAAGCTGACGGACAATCTCAAGCACTGGGACGTGGTCGACGAGGCGCCTCACGAGGTGTGGGAGTCG
TCCAAGGGTAGCAAGCGAATCGAGGAGCGTCTCCGACAGCTAGTACACGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail