Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8508
Gene name
Locationscaffold_96:19092..21303
Strand+
Gene length (bp)2211
Transcript length (bp)2076
Coding sequence length (bp)2073
Protein length (aa) 691

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00615 RGS Regulator of G protein signaling domain 6.7E-35 523 667
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 2.8E-20 403 484

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38093|FLBA_EMENI Developmental regulator flbA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=flbA PE=2 SV=1 58 690 0.0E+00
sp|Q09777|RGS1_SCHPO Regulator of G-protein signaling 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgs1 PE=2 SV=1 167 661 1.0E-38
sp|P11972|SST2_YEAST Protein SST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SST2 PE=1 SV=2 361 619 7.0E-25
sp|P49802|RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens GN=RGS7 PE=1 SV=3 524 670 4.0E-10
sp|O46470|RGS7_BOVIN Regulator of G-protein signaling 7 OS=Bos taurus GN=RGS7 PE=1 SV=1 524 670 7.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38093|FLBA_EMENI Developmental regulator flbA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=flbA PE=2 SV=1 58 690 0.0E+00
sp|Q09777|RGS1_SCHPO Regulator of G-protein signaling 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgs1 PE=2 SV=1 167 661 1.0E-38
sp|P11972|SST2_YEAST Protein SST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SST2 PE=1 SV=2 361 619 7.0E-25
sp|P49802|RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens GN=RGS7 PE=1 SV=3 524 670 4.0E-10
sp|O46470|RGS7_BOVIN Regulator of G-protein signaling 7 OS=Bos taurus GN=RGS7 PE=1 SV=1 524 670 7.0E-10
sp|P49803|RGS7_RAT Regulator of G-protein signaling 7 OS=Rattus norvegicus GN=Rgs7 PE=1 SV=2 524 670 1.0E-09
sp|O54829|RGS7_MOUSE Regulator of G-protein signaling 7 OS=Mus musculus GN=Rgs7 PE=1 SV=2 524 670 2.0E-09
sp|Q9QZB1|RGS20_MOUSE Regulator of G-protein signaling 20 OS=Mus musculus GN=Rgs20 PE=1 SV=1 522 669 4.0E-08
sp|Q9QZB0|RGS17_MOUSE Regulator of G-protein signaling 17 OS=Mus musculus GN=Rgs17 PE=1 SV=1 519 665 1.0E-07
sp|P34295|RGS1_CAEEL Regulator of G-protein signaling rgs-1 OS=Caenorhabditis elegans GN=rgs-1 PE=2 SV=3 519 690 2.0E-07
sp|P79348|RGS20_BOVIN Regulator of G-protein signaling 20 OS=Bos taurus GN=RGS20 PE=1 SV=2 521 670 3.0E-07
sp|Q5M8L6|RGS1_XENTR Regulator of G-protein signaling 1 OS=Xenopus tropicalis GN=rgs1 PE=2 SV=2 521 662 4.0E-07
sp|Q9PWA0|RGS17_CHICK Regulator of G-protein signaling 17 OS=Gallus gallus GN=RGS17 PE=2 SV=1 519 666 4.0E-07
sp|Q9UGC6|RGS17_HUMAN Regulator of G-protein signaling 17 OS=Homo sapiens GN=RGS17 PE=1 SV=2 519 665 4.0E-07
sp|Q9PWA1|RGS20_CHICK Regulator of G-protein signaling 20 OS=Gallus gallus GN=RGS20 PE=2 SV=1 522 670 5.0E-07
sp|O76081|RGS20_HUMAN Regulator of G-protein signaling 20 OS=Homo sapiens GN=RGS20 PE=1 SV=4 518 670 5.0E-07
sp|P11972|SST2_YEAST Protein SST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SST2 PE=1 SV=2 188 377 9.0E-07
sp|Q8K443|RGS13_MOUSE Regulator of G-protein signaling 13 OS=Mus musculus GN=Rgs13 PE=1 SV=1 522 670 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0007165 signal transduction No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.5816 0.328 0.0309 0.2732 0.1606 0.03 0.1718 0.2876 0.232 0.0278

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1983
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|708
Ophiocordyceps australis map64 (Brazil) OphauB2|5202
Ophiocordyceps camponoti-floridani Ophcf2|02810
Ophiocordyceps camponoti-rufipedis Ophun1|138
Ophiocordyceps kimflemingae Ophio5|8508 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2183

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8508
MAAISNPLTTVSPKPLPPVRSELPKRKLSLSTPRSSVSDRSTDPTTAAAARHASNASVGSASSRSQRSLLNRAVA
ALDRTTQSAIASLSDPVIRPRQSVSGLSRLSLVPATPPCSEPSSPEKKTEFKVLSSPTSARGPRLDDSLSAHQDP
TEESPVGPCPETELCRSPTPVTSPVRSPARSPVIDGKMHQTSSRLLRMTDDDRPFTRDFKDLFATLVVSLLPLSA
HRVRLSKVEYTFLSEDAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKDMARSICQRFLEARFIESADG
KYQQVYNMKGSVWQLTPKGITVLDRFCARNGIQQKQVAELSSINSAQLVILERDQMTDKLLNDLGTIEVIFRRFI
GSDGRNLKATATAADSDSLHDYRDGLTGVKMAAERKVNGRIHRDTFTGKATTDWLMDCSTIIDRRETVEIATLFV
EYGLIEAVTQDKVFIQQNTGYNLFQPTKHAVYQLTQRGKDLISGNGSRGRASGSEGGAASQRNGICRDSNTQRLD
KILTDPALRLLFRENLRETHCEENLSFHQDVTEFVRGCKVAIRQAQKSPTVTSMDSIKEIMAQAYGIYNAFLAPG
SPCELNIDHQLRNNLATRMTKAVGQDNSMIDTLQEVTTLFEDAQNAVFKLMASDSVPKFLRNAKYEQQLRIHDLD
VNGRLPERSQSRSTRR
Coding >Ophio5|8508
ATGGCCGCCATCTCGAATCCCCTCACGACAGTCTCGCCGAAACCGCTTCCGCCAGTCAGGTCGGAGCTGCCGAAG
CGCAAGCTCAGCCTGTCGACGCCTCGCTCTTCCGTCTCGGACCGTTCGACCGATCCGACGACTGCCGCCGCCGCC
CGCCACGCCAGCAACGCTTCGGTCGGCTCCGCCTCGAGCCGCTCCCAGCGCAGCCTTCTTAATCGCGCCGTGGCC
GCTCTCGACAGGACGACGCAGAGCGCCATCGCCAGCCTGTCGGACCCTGTCATCCGTCCCCGCCAATCCGTCTCG
GGCCTGTCGCGCCTATCGCTCGTGCCAGCCACCCCGCCCTGCTCGGAGCCGTCGAGCCCGGAGAAGAAGACCGAG
TTCAAGGTCTTGTCCAGCCCGACGTCGGCCCGAGGCCCCAGGCTCGACGACAGCCTGTCCGCCCACCAGGACCCG
ACCGAAGAGTCCCCCGTCGGGCCCTGTCCGGAGACGGAGCTGTGCCGCTCTCCCACCCCCGTCACGTCTCCCGTC
AGGTCCCCCGCCAGGTCTCCCGTTATCGACGGCAAGATGCACCAGACGTCGTCGCGCTTGCTGCGCATGACCGAC
GACGACAGGCCCTTCACTAGGGACTTCAAGGACCTCTTCGCCACCCTCGTCGTCAGCCTTCTCCCCCTCTCCGCA
CACCGCGTCCGCCTCTCCAAGGTTGAGTATACCTTCTTGTCCGAAGATGCCATCAACAACCTCGGTTCCCTCAAG
TTCTCTCAATCGAACCGTATGCCGGACCCCAAAGACCCCTCCCGCATCGTCACCACCACCACCACCACCACCTTC
TCCATGGCCAAGGACATGGCCAGGTCCATCTGCCAGCGCTTCCTCGAGGCCCGCTTCATCGAGTCGGCCGACGGC
AAGTACCAGCAGGTCTACAACATGAAGGGTTCCGTGTGGCAGCTCACGCCAAAGGGCATCACCGTCCTCGACCGC
TTCTGCGCCCGCAACGGCATCCAGCAGAAGCAGGTGGCCGAGCTGTCGAGCATCAACTCGGCCCAGCTCGTCATT
CTCGAGCGCGATCAAATGACGGACAAGTTGCTCAACGACCTCGGAACCATCGAGGTCATTTTCCGCCGGTTCATC
GGCTCCGACGGCCGCAACCTCAAGGCCACGGCCACGGCCGCCGACTCGGACTCGCTCCACGACTATCGCGACGGC
CTCACCGGCGTCAAGATGGCCGCCGAGCGCAAGGTCAATGGCCGCATACACCGCGACACCTTTACCGGCAAGGCG
ACGACCGATTGGCTCATGGACTGTTCCACCATCATCGATCGCCGCGAGACGGTCGAGATCGCCACCCTGTTCGTC
GAGTACGGCCTGATCGAGGCCGTGACCCAGGACAAGGTCTTTATCCAACAAAACACGGGCTACAACTTGTTCCAG
CCGACAAAGCACGCCGTCTATCAGCTGACCCAGCGTGGCAAGGACCTCATCAGCGGCAACGGCTCCCGAGGTCGT
GCCTCGGGCAGCGAGGGCGGCGCGGCCTCGCAGCGGAACGGCATCTGCCGCGACTCGAACACGCAGCGCCTCGAC
AAAATCCTCACCGACCCGGCCCTCCGCCTCCTCTTCCGGGAGAACCTGCGGGAGACGCACTGCGAGGAGAACCTG
TCCTTTCACCAGGACGTGACCGAGTTCGTCCGCGGCTGCAAGGTGGCCATCCGGCAGGCGCAGAAGTCGCCGACG
GTCACGTCGATGGACTCCATTAAGGAGATCATGGCCCAGGCCTACGGAATCTACAACGCCTTCCTTGCCCCCGGG
TCGCCCTGCGAGCTCAACATTGACCACCAGCTGCGGAACAACCTGGCGACGCGCATGACCAAGGCCGTGGGGCAG
GACAACTCGATGATCGACACGTTGCAGGAGGTGACGACGCTGTTTGAGGACGCCCAGAATGCCGTTTTTAAGCTG
ATGGCCAGCGACTCGGTGCCCAAGTTCCTCCGCAACGCAAAGTACGAGCAGCAGCTCAGGATCCACGATCTCGAC
GTCAACGGCCGGCTGCCGGAACGAAGTCAGAGTCGGTCAACCCGTCGG
Transcript >Ophio5|8508
ATGGCCGCCATCTCGAATCCCCTCACGACAGTCTCGCCGAAACCGCTTCCGCCAGTCAGGTCGGAGCTGCCGAAG
CGCAAGCTCAGCCTGTCGACGCCTCGCTCTTCCGTCTCGGACCGTTCGACCGATCCGACGACTGCCGCCGCCGCC
CGCCACGCCAGCAACGCTTCGGTCGGCTCCGCCTCGAGCCGCTCCCAGCGCAGCCTTCTTAATCGCGCCGTGGCC
GCTCTCGACAGGACGACGCAGAGCGCCATCGCCAGCCTGTCGGACCCTGTCATCCGTCCCCGCCAATCCGTCTCG
GGCCTGTCGCGCCTATCGCTCGTGCCAGCCACCCCGCCCTGCTCGGAGCCGTCGAGCCCGGAGAAGAAGACCGAG
TTCAAGGTCTTGTCCAGCCCGACGTCGGCCCGAGGCCCCAGGCTCGACGACAGCCTGTCCGCCCACCAGGACCCG
ACCGAAGAGTCCCCCGTCGGGCCCTGTCCGGAGACGGAGCTGTGCCGCTCTCCCACCCCCGTCACGTCTCCCGTC
AGGTCCCCCGCCAGGTCTCCCGTTATCGACGGCAAGATGCACCAGACGTCGTCGCGCTTGCTGCGCATGACCGAC
GACGACAGGCCCTTCACTAGGGACTTCAAGGACCTCTTCGCCACCCTCGTCGTCAGCCTTCTCCCCCTCTCCGCA
CACCGCGTCCGCCTCTCCAAGGTTGAGTATACCTTCTTGTCCGAAGATGCCATCAACAACCTCGGTTCCCTCAAG
TTCTCTCAATCGAACCGTATGCCGGACCCCAAAGACCCCTCCCGCATCGTCACCACCACCACCACCACCACCTTC
TCCATGGCCAAGGACATGGCCAGGTCCATCTGCCAGCGCTTCCTCGAGGCCCGCTTCATCGAGTCGGCCGACGGC
AAGTACCAGCAGGTCTACAACATGAAGGGTTCCGTGTGGCAGCTCACGCCAAAGGGCATCACCGTCCTCGACCGC
TTCTGCGCCCGCAACGGCATCCAGCAGAAGCAGGTGGCCGAGCTGTCGAGCATCAACTCGGCCCAGCTCGTCATT
CTCGAGCGCGATCAAATGACGGACAAGTTGCTCAACGACCTCGGAACCATCGAGGTCATTTTCCGCCGGTTCATC
GGCTCCGACGGCCGCAACCTCAAGGCCACGGCCACGGCCGCCGACTCGGACTCGCTCCACGACTATCGCGACGGC
CTCACCGGCGTCAAGATGGCCGCCGAGCGCAAGGTCAATGGCCGCATACACCGCGACACCTTTACCGGCAAGGCG
ACGACCGATTGGCTCATGGACTGTTCCACCATCATCGATCGCCGCGAGACGGTCGAGATCGCCACCCTGTTCGTC
GAGTACGGCCTGATCGAGGCCGTGACCCAGGACAAGGTCTTTATCCAACAAAACACGGGCTACAACTTGTTCCAG
CCGACAAAGCACGCCGTCTATCAGCTGACCCAGCGTGGCAAGGACCTCATCAGCGGCAACGGCTCCCGAGGTCGT
GCCTCGGGCAGCGAGGGCGGCGCGGCCTCGCAGCGGAACGGCATCTGCCGCGACTCGAACACGCAGCGCCTCGAC
AAAATCCTCACCGACCCGGCCCTCCGCCTCCTCTTCCGGGAGAACCTGCGGGAGACGCACTGCGAGGAGAACCTG
TCCTTTCACCAGGACGTGACCGAGTTCGTCCGCGGCTGCAAGGTGGCCATCCGGCAGGCGCAGAAGTCGCCGACG
GTCACGTCGATGGACTCCATTAAGGAGATCATGGCCCAGGCCTACGGAATCTACAACGCCTTCCTTGCCCCCGGG
TCGCCCTGCGAGCTCAACATTGACCACCAGCTGCGGAACAACCTGGCGACGCGCATGACCAAGGCCGTGGGGCAG
GACAACTCGATGATCGACACGTTGCAGGAGGTGACGACGCTGTTTGAGGACGCCCAGAATGCCGTTTTTAAGCTG
ATGGCCAGCGACTCGGTGCCCAAGTTCCTCCGCAACGCAAAGTACGAGCAGCAGCTCAGGATCCACGATCTCGAC
GTCAACGGCCGGCTGCCGGAACGAAGTCAGAGTCGGTCAACCCGTCGGTGA
Gene >Ophio5|8508
ATGGCCGCCATCTCGAATCCCCTCACGACAGTCTCGCCGAAACCGCTTCCGCCAGTCAGGTCGGAGCTGCCGAAG
CGCAAGCTCAGCCTGTCGACGCCTCGCTCTTCCGTCTCGGACCGTTCGACCGATCCGACGACTGCCGCCGCCGCC
CGCCACGCCAGCAACGCTTCGGTCGGCTCCGCCTCGAGCCGCTCCCAGCGCAGCCTTCTTAATCGCGCCGTGGCC
GCTCTCGACAGGACGACGCAGAGCGCCATCGCCAGCCTGTCGGACCCTGTCATCCGTCCCCGCCAATCCGTCTCG
GGCCTGTCGCGCCTATCGCTCGTGCCAGCCACCCCGCCCTGCTCGGAGCCGTCGAGCCCGGAGAAGAAGACCGAG
TTCAAGGTCTTGTCCAGCCCGACGTCGGCCCGAGGCCCCAGGCTCGACGACAGCCTGTCCGCCCACCAGGACCCG
ACCGAAGAGTCCCCCGTCGGGCCCTGTCCGGAGACGGAGCTGTGCCGCTCTCCCACCCCCGTCACGTCTCCCGTC
AGGTCCCCCGCCAGGTCTCCCGTTATCGACGGCAAGATGCACCAGACGTCGTCGCGCTTGCTGCGCATGACCGAC
GACGACAGGCCCTTCACTAGGGTAGCCTCTCCCCCGACCGCTGTGCCATGTTCCCCACGAGCCCCTCTTGTGCTG
ACGTTGCCGCACCCCAACAGGACTTCAAGGACCTCTTCGCCACCCTCGTCGTCAGCCTTCTCCCCCTCTCCGCAC
ACCGCGTCCGCCTCTCCAAGGTTGAGTATACCTTCTTGTCCGAAGATGCCATCAACAACCTCGGTTCCCTCAAGT
TCTCTCAATCGAACCGTATGCCGGACCCCAAAGACCCCTCCCGCATCGTCACCACCACCACCACCACCACCTTCT
CCATGGCCAAGGACATGGCCAGGTCCATCTGCCAGCGCTTCCTCGAGGCCCGCTTCATCGAGTCGGCCGACGGCA
AGTACCAGCAGGTCTACAACATGAAGGGTTCCGTGTGGCAGCTCACGCCAAAGGGCATCACCGTCCTCGACCGCT
TCTGCGCCCGCAACGGCATCCAGCAGAAGCAGGTGGCCGAGCTGTCGAGCATCAACTCGGCCCAGCTCGTCATTC
TCGAGCGCGATCAAATGACGGACAAGTTGCTCAACGACCTCGGAACCATCGAGGTCATTTTCCGCCGGTTCATCG
GCTCCGACGGCCGCAACCTCAAGGCCACGGCCACGGCCGCCGACTCGGACTCGCTCCACGACTATCGCGACGGCC
TCACCGGCGTCAAGATGGCCGCCGAGCGCAAGGTCAATGGCCGCATACACCGCGACACCTTTACCGGCAAGGCGA
CGACCGATTGGCTCATGGACTGTTCCACCATCATCGATCGCCGCGAGACGGTCGAGATCGCCACCCTGTTCGTCG
AGTACGGCCTGATCGAGGCCGTGACCCAGGACAAGGTCTTTATCCAACAAAACACGGGCTACAACTTGTTCCAGC
CGACAAAGCACGCCGTCTATCAGCTGACCCAGCGTGGCAAGGACCTCATCAGCGGCAACGGCTCCCGAGGTCGTG
CCTCGGGCAGCGAGGGCGGCGCGGCCTCGCAGCGGAACGGCATCTGCCGCGACTCGAACACGCAGCGCCTCGACA
AAATCCTCACCGACCCGGCCCTCCGCCTCCTCTTCCGGGAGAACCTGCGGGAGACGCACTGCGAGGAGAACCTGT
CCTTTCACCAGGACGTGACCGAGTTCGTCCGCGGCTGCAAGGTGGCCATCCGGCAGGCGCAGAAGTCGCCGACGG
TCACGTCGATGGACTCCATTAAGGAGATCATGGCCCAGGCCTACGGAATCTACAACGCCTTCCTTGCCCCCGGGT
CGCCCTGCGAGCTCAACATTGACCACCAGCTGCGGAACAACCTGGCGACGCGCATGACCAAGGCCGTGGGGCAGG
ACAACTCGATGATCGACACGTTGCAGGAGGTGACGACGCTGTTTGAGGACGCCCAGAATGCCGTTTTTAAGCTGA
TGGCCAGCGTGCGTGCCCTTCAACTGTATGACCTTGCCAGGGTGATGTAATGACTGACGGGAGGTACAGGACTCG
GTGCCCAAGTTCCTCCGCAACGCAAAGTACGAGCAGCAGCTCAGGATCCACGATCTCGACGTCAACGGCCGGCTG
CCGGAACGAAGTCAGAGTCGGTCAACCCGTCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail