Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8500
Gene name
Locationscaffold_96:98..1373
Strand+
Gene length (bp)1275
Transcript length (bp)1137
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.9E-14 1 278
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 7.8E-11 6 293

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 18 365 5.0E-46
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 2 290 5.0E-32
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 1 360 6.0E-30
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 1 360 6.0E-30
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 2 300 7.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 18 365 5.0E-46
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 2 290 5.0E-32
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 1 360 6.0E-30
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 1 360 6.0E-30
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 2 300 7.0E-30
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 2 295 4.0E-29
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 2 377 8.0E-28
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 2 377 2.0E-27
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 2 298 6.0E-27
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 5 364 9.0E-21
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 1 378 9.0E-21
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 2 308 7.0E-19
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 4 354 8.0E-17
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 3 288 1.0E-14
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 22 360 3.0E-14
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 4 209 2.0E-10
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 5 288 5.0E-10
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 1 181 7.0E-09
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 1 181 7.0E-09
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 1 338 1.0E-08
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 7 209 7.0E-08
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 7 209 8.0E-08
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 3 303 1.0E-07
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 4 187 1.0E-07
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 4 288 5.0E-07
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 4 288 5.0E-07
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 2 194 2.0E-06
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 2 194 2.0E-06
sp|P14551|TCR_STRRM Tetracycline resistance determinant OS=Streptomyces rimosus GN=tetB PE=3 SV=1 111 281 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 67 89 22
3 99 118 19
4 138 160 22
5 175 197 22
6 202 219 17
7 229 251 22
8 264 286 22
9 337 359 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8500
MWGIASVAGPLLGGAFTQDVTWRWCFYINLPIGGLAILIVFFVVHINRNTAAGSDSPFVARLRQLDLSGIAIFVP
AIICLLLALQWGGADYPWHDSRVVGLFVGFGLMIALFAALQLYKGDGGTLPPKLFADRNVLCAMLFAFFFGAAFF
PLVFYLSLYFQAIQGVSAVQAGIKILPLLLATVFVSILTGVIVSAVGYYNVVIIPCMLLFTVGSGMLTTLDIDTP
FGKWFGYQVLTGLGIGAGFQTGVVVIQTVLPQDMVPVGVACVQFFQALGGAIFFAVAQTLFQNGLINGVDAAKLA
IDGRVFINSGASEIKQVLARLDRLDALVPVLGSYMTGLRHTFFISVACAGCAFFCVLGLQWKSVKKSPYGRNRPK
EEA
Coding >Ophio5|8500
ATGTGGGGCATCGCCTCGGTGGCCGGCCCCTTACTCGGAGGCGCCTTCACCCAAGACGTCACCTGGCGATGGTGC
TTCTACATCAACCTTCCCATCGGCGGCCTCGCCATCCTCATCGTCTTCTTCGTCGTCCACATCAACCGCAACACC
GCCGCCGGCTCCGACTCGCCCTTCGTCGCTCGCCTCCGCCAGCTCGACCTCAGCGGCATCGCCATCTTCGTGCCC
GCCATCATCTGCCTGCTGCTGGCCTTGCAGTGGGGAGGCGCCGACTATCCCTGGCACGACTCGCGTGTCGTCGGC
CTCTTCGTCGGCTTCGGCCTCATGATCGCCCTCTTTGCCGCCCTGCAGCTCTACAAGGGTGACGGCGGCACGCTG
CCGCCCAAGCTGTTTGCCGACCGCAACGTCCTCTGCGCCATGCTCTTTGCCTTTTTCTTCGGCGCCGCCTTTTTC
CCTCTGGTATTTTACCTCTCCCTGTACTTCCAGGCCATCCAGGGCGTCAGCGCCGTCCAGGCCGGCATCAAGATC
CTACCCCTTCTCCTGGCCACCGTCTTCGTCTCCATCCTCACCGGCGTCATCGTCTCGGCCGTCGGCTACTACAAC
GTCGTCATCATCCCCTGCATGCTCCTCTTCACCGTCGGCTCCGGCATGCTCACCACGCTCGACATCGACACCCCC
TTTGGTAAGTGGTTCGGCTATCAGGTCCTGACGGGCCTCGGCATCGGCGCCGGCTTCCAGACCGGTGTCGTCGTC
ATCCAGACCGTTCTGCCCCAGGACATGGTCCCCGTCGGCGTCGCCTGCGTCCAGTTCTTCCAGGCCCTCGGCGGC
GCCATCTTCTTCGCCGTCGCCCAGACCCTCTTCCAGAACGGTCTCATCAACGGCGTCGACGCCGCCAAGCTGGCC
ATCGACGGTCGCGTCTTCATCAACAGCGGCGCCTCCGAGATCAAGCAGGTTCTCGCCCGCCTCGACCGCCTCGAC
GCCCTCGTCCCCGTCCTCGGTTCCTATATGACCGGTCTGCGTCATACCTTTTTCATCTCCGTCGCCTGCGCCGGC
TGTGCCTTCTTTTGCGTCCTCGGTCTGCAGTGGAAGTCGGTCAAGAAGAGTCCGTATGGCCGGAACAGGCCCAAG
GAGGAGGCA
Transcript >Ophio5|8500
ATGTGGGGCATCGCCTCGGTGGCCGGCCCCTTACTCGGAGGCGCCTTCACCCAAGACGTCACCTGGCGATGGTGC
TTCTACATCAACCTTCCCATCGGCGGCCTCGCCATCCTCATCGTCTTCTTCGTCGTCCACATCAACCGCAACACC
GCCGCCGGCTCCGACTCGCCCTTCGTCGCTCGCCTCCGCCAGCTCGACCTCAGCGGCATCGCCATCTTCGTGCCC
GCCATCATCTGCCTGCTGCTGGCCTTGCAGTGGGGAGGCGCCGACTATCCCTGGCACGACTCGCGTGTCGTCGGC
CTCTTCGTCGGCTTCGGCCTCATGATCGCCCTCTTTGCCGCCCTGCAGCTCTACAAGGGTGACGGCGGCACGCTG
CCGCCCAAGCTGTTTGCCGACCGCAACGTCCTCTGCGCCATGCTCTTTGCCTTTTTCTTCGGCGCCGCCTTTTTC
CCTCTGGTATTTTACCTCTCCCTGTACTTCCAGGCCATCCAGGGCGTCAGCGCCGTCCAGGCCGGCATCAAGATC
CTACCCCTTCTCCTGGCCACCGTCTTCGTCTCCATCCTCACCGGCGTCATCGTCTCGGCCGTCGGCTACTACAAC
GTCGTCATCATCCCCTGCATGCTCCTCTTCACCGTCGGCTCCGGCATGCTCACCACGCTCGACATCGACACCCCC
TTTGGTAAGTGGTTCGGCTATCAGGTCCTGACGGGCCTCGGCATCGGCGCCGGCTTCCAGACCGGTGTCGTCGTC
ATCCAGACCGTTCTGCCCCAGGACATGGTCCCCGTCGGCGTCGCCTGCGTCCAGTTCTTCCAGGCCCTCGGCGGC
GCCATCTTCTTCGCCGTCGCCCAGACCCTCTTCCAGAACGGTCTCATCAACGGCGTCGACGCCGCCAAGCTGGCC
ATCGACGGTCGCGTCTTCATCAACAGCGGCGCCTCCGAGATCAAGCAGGTTCTCGCCCGCCTCGACCGCCTCGAC
GCCCTCGTCCCCGTCCTCGGTTCCTATATGACCGGTCTGCGTCATACCTTTTTCATCTCCGTCGCCTGCGCCGGC
TGTGCCTTCTTTTGCGTCCTCGGTCTGCAGTGGAAGTCGGTCAAGAAGAGTCCGTATGGCCGGAACAGGCCCAAG
GAGGAGGCATAG
Gene >Ophio5|8500
ATGTGGGGCATCGCCTCGGTGGCCGGCCCCTTACTCGGAGGCGCCTTCACCCAAGACGTCACCTGGCGATGGTGC
TTCTACATCAACCTTCCCATCGGCGGCCTCGCCATCCTCATCGTCTTCTTCGTCGTCCACATCAACCGCAACACC
GCCGCCGGCTCCGACTCGCCCTTCGTCGCTCGCCTCCGCCAGCTCGACCTCAGCGGCATCGCCATCTTCGTGCCC
GCCATCATCTGCCTGCTGCTGGCCTTGCAGTGGGGAGGCGCCGACTATCCCTGGCACGACTCGCGTGTCGTCGGC
CTCTTCGTCGGCTTCGGCCTCATGATCGCCCTCTTTGCCGCCCTGCAGCTCTACAAGGGTGACGGCGGCACGCTG
CCGCCCAAGCTGTTTGCCGACCGCAACGTCCTCTGCGCCATGCTCTTTGCCTTTTTCTTCGGCGCCGCCTTTTTC
CCTCTGGTATTTTACCTCTGTACGTCTCCTCTCCTCTCCTCCCTTCTCTTCCCATCCCTTCCCCGTCCCTTGCTT
TTACCGTTGCTCCTATTCCTTTGCATGCTCATGACCTCTTCTTCTTCTTCTTCTTCTTCTTCTTCCTCTTCCTCT
TCTTTAGCCCTGTACTTCCAGGCCATCCAGGGCGTCAGCGCCGTCCAGGCCGGCATCAAGATCCTACCCCTTCTC
CTGGCCACCGTCTTCGTCTCCATCCTCACCGGCGTCATCGTCTCGGCCGTCGGCTACTACAACGTCGTCATCATC
CCCTGCATGCTCCTCTTCACCGTCGGCTCCGGCATGCTCACCACGCTCGACATCGACACCCCCTTTGGTAAGTGG
TTCGGCTATCAGGTCCTGACGGGCCTCGGCATCGGCGCCGGCTTCCAGACCGGTGTCGTCGTCATCCAGACCGTT
CTGCCCCAGGACATGGTCCCCGTCGGCGTCGCCTGCGTCCAGTTCTTCCAGGCCCTCGGCGGCGCCATCTTCTTC
GCCGTCGCCCAGACCCTCTTCCAGAACGGTCTCATCAACGGCGTCGACGCCGCCAAGCTGGCCATCGACGGTCGC
GTCTTCATCAACAGCGGCGCCTCCGAGATCAAGCAGGTTCTCGCCCGCCTCGACCGCCTCGACGCCCTCGTCCCC
GTCCTCGGTTCCTATATGACCGGTCTGCGTCATACCTTTTTCATCTCCGTCGCCTGCGCCGGCTGTGCCTTCTTT
TGCGTCCTCGGTCTGCAGTGGAAGTCGGTCAAGAAGAGTCCGTATGGCCGGAACAGGCCCAAGGAGGAGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail