Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8495
Gene name
Locationscaffold_956:233..1588
Strand-
Gene length (bp)1355
Transcript length (bp)1047
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.67 0.00 1.55
CcL In ants, during behavior modification 10.96 3.00 18.91
CcD In ants, recently dead 5.53 1.27 9.79

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.002815 yes
CcL CcD 0.071402 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8495
MLELIMLLLSVTLCLVPGVISSPPQQPPTTRRLGSWEVERNSEGDPFGLTLEKPRLPSAPRTNSVPLLEPLLFKA
TSNQVEVHGESSPRPPTAAIKKTLHPPTVAFCQNSRYRGFCDRVVLTRASYCYQVPRSLRWTVSSIQLINVVGKC
WFFKQFNCQDESFDTSDSIGTIWKHHGEFQNNIRSFYCIYPLPLLYQHTRFTGRVFAVDVPLGYCADVPPPFDNA
ASSFSIPEDMYRCLLFPAHGCRGDYLEAYEDIAEISAVSTTLNDAIGSILCSPQRREPLLSALLPQFTPEPEPAP
APVAELESSSGCVSRECGPVGEIWGYRVPRIHLPPYRQMIPAPRSLLS
Coding >Ophio5|8495
ATGCTTGAACTGATTATGCTACTCCTCTCCGTCACGCTTTGCCTCGTGCCGGGCGTGATATCATCTCCGCCTCAA
CAGCCGCCCACGACGCGCCGGCTTGGCTCATGGGAGGTGGAGCGCAACTCTGAGGGGGACCCCTTTGGTCTGACG
CTTGAAAAACCCCGACTCCCGTCTGCTCCCAGGACGAATTCCGTGCCTCTGCTAGAACCTCTTCTTTTCAAGGCT
ACCTCCAACCAAGTCGAAGTACACGGCGAGAGCTCGCCACGACCGCCTACAGCCGCCATCAAAAAAACTCTTCAT
CCACCCACTGTCGCCTTTTGCCAGAACTCCCGCTACAGAGGATTTTGCGACCGGGTCGTACTCACCAGGGCCTCG
TATTGCTACCAGGTGCCTCGTAGTCTTCGCTGGACTGTTTCGTCGATCCAACTCATCAATGTGGTTGGAAAGTGC
TGGTTTTTCAAACAGTTCAACTGCCAGGACGAATCGTTCGACACTTCCGACAGCATTGGGACCATCTGGAAACAC
CATGGAGAGTTTCAAAACAATATTCGCTCCTTCTATTGCATATATCCCCTGCCTTTACTCTACCAGCACACCAGG
TTCACTGGTCGCGTTTTTGCCGTCGACGTGCCTTTAGGGTACTGCGCCGACGTGCCTCCCCCTTTCGACAATGCT
GCGTCGTCGTTCAGCATCCCGGAAGATATGTATAGGTGCTTATTGTTTCCAGCTCATGGCTGCCGAGGGGATTAC
CTCGAAGCGTATGAGGACATTGCGGAAATCTCCGCTGTGAGCACGACACTCAATGACGCCATCGGATCCATCCTA
TGCTCACCGCAAAGGCGCGAGCCGCTATTGTCCGCGCTGCTGCCGCAATTCACGCCTGAACCAGAACCGGCGCCG
GCGCCCGTTGCCGAGCTCGAATCGTCGTCAGGCTGTGTGAGTAGGGAATGCGGGCCTGTGGGAGAAATCTGGGGT
TACAGAGTCCCGCGAATTCATCTCCCACCCTATCGACAGATGATTCCCGCTCCCAGATCTCTGCTGTCG
Transcript >Ophio5|8495
ATGCTTGAACTGATTATGCTACTCCTCTCCGTCACGCTTTGCCTCGTGCCGGGCGTGATATCATCTCCGCCTCAA
CAGCCGCCCACGACGCGCCGGCTTGGCTCATGGGAGGTGGAGCGCAACTCTGAGGGGGACCCCTTTGGTCTGACG
CTTGAAAAACCCCGACTCCCGTCTGCTCCCAGGACGAATTCCGTGCCTCTGCTAGAACCTCTTCTTTTCAAGGCT
ACCTCCAACCAAGTCGAAGTACACGGCGAGAGCTCGCCACGACCGCCTACAGCCGCCATCAAAAAAACTCTTCAT
CCACCCACTGTCGCCTTTTGCCAGAACTCCCGCTACAGAGGATTTTGCGACCGGGTCGTACTCACCAGGGCCTCG
TATTGCTACCAGGTGCCTCGTAGTCTTCGCTGGACTGTTTCGTCGATCCAACTCATCAATGTGGTTGGAAAGTGC
TGGTTTTTCAAACAGTTCAACTGCCAGGACGAATCGTTCGACACTTCCGACAGCATTGGGACCATCTGGAAACAC
CATGGAGAGTTTCAAAACAATATTCGCTCCTTCTATTGCATATATCCCCTGCCTTTACTCTACCAGCACACCAGG
TTCACTGGTCGCGTTTTTGCCGTCGACGTGCCTTTAGGGTACTGCGCCGACGTGCCTCCCCCTTTCGACAATGCT
GCGTCGTCGTTCAGCATCCCGGAAGATATGTATAGGTGCTTATTGTTTCCAGCTCATGGCTGCCGAGGGGATTAC
CTCGAAGCGTATGAGGACATTGCGGAAATCTCCGCTGTGAGCACGACACTCAATGACGCCATCGGATCCATCCTA
TGCTCACCGCAAAGGCGCGAGCCGCTATTGTCCGCGCTGCTGCCGCAATTCACGCCTGAACCAGAACCGGCGCCG
GCGCCCGTTGCCGAGCTCGAATCGTCGTCAGGCTGTGTGAGTAGGGAATGCGGGCCTGTGGGAGAAATCTGGGGT
TACAGAGTCCCGCGAATTCATCTCCCACCCTATCGACAGATGATTCCCGCTCCCAGATCTCTGCTGTCGTGA
Gene >Ophio5|8495
ATGCTTGAACTGATTATGCTACTCCTCTCCGTCACGCTTTGCCTCGTGCCGGGCGTGATATCATCTCCGCCTCAA
CAGCCGCCCACGACGCGCCGGCTTGGCTCATGGGAGGTGGAGCGCAACTCTGAGGGGGACCCCTTTGGTCTGACG
CTTGAAAAACCCCGACTCCCGTCTGCTCCCAGGACGAATTCCGTGCCTCTGCTAGAACCTCTTCTTTTCAAGGCT
ACCTCCAACCAAGTCGAAGTACACGGCGAGAGCTCGCCACGACCGCCTACAGCCGCCATCAAAAAAACTCTTCAT
CCACCCACTGTCGCCTTTTGCCAGAACTCCCGCTACAGAGGATTTTGCGACCGGGTCGTACTCACCAGGGCCTCG
TATTGCTGTTTGTTTCCCCCCATCCCCACCCCTTGCTGGTTGGTTAGTCTTGGCTAATGGGTAGCTCGCTTCAAA
AGACCAGGTGCCTCGTAGTCTTCGCTGGACTGTTTCGTCGATCCAACTCATCAATGTGGTTGGAAAGTGCTGGTT
TTTCAAGTATGAGATTGCTTCTTTAATATCCTGAAGCTCGTCGTGAATCTGACATGGAAGCGTTATTCTTCCTTC
TTTAGACAGTTCAACTGCCAGGACGAATCGTTCGACACTTCCGACAGCATTGGGACCATCTGGAAACACCATGGA
GAGTTTCAAAACAATATTCGCTCCTTCTATTGCATATATCCCCTGCCTTTACTCTACCAGCACACCAGGTTCACT
GGTCGCGTTTTTGCCGTCGACGTGCCTTTAGGGTACTGCGGTGAGTCGTGCTTATTCTCCTTCTTCTTCTTCTTT
CTCGACCCCTTCGCCATCCTAACACACCAAACCATTCCACCGTTATTCCACTGACCGCTCTTCGCAGCCGACGTG
CCTCCCCCTTTCGACAATGCTGCGTCGTCGTTCAGCATCCCGGAAGATATGTATAGGTGCTTATTGTTTCCGTAA
GCCGCTCATTTTTCTCCTCATGGCTGGCCATGGTAAACTGAACCGCGTCTTTTTATAGAGCTCATGGCTGCCGAG
GGGATTACCTCGAAGCGTATGAGGACATTGCGGAAATCTCCGCTGTGAGCACGACACTCAATGACGCCATCGGAT
CCATCCTATGCTCACCGCAAAGGCGCGAGCCGCTATTGTCCGCGCTGCTGCCGCAATTCACGCCTGAACCAGAAC
CGGCGCCGGCGCCCGTTGCCGAGCTCGAATCGTCGTCAGGCTGTGTGAGTAGGGAATGCGGGCCTGTGGGAGAAA
TCTGGGGTTACAGAGTCCCGCGAATTCATCTCCCACCCTATCGACAGATGATTCCCGCTCCCAGATCTCTGCTGT
CGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail