Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8494
Gene name
Locationscaffold_955:3558..4181
Strand-
Gene length (bp)623
Transcript length (bp)564
Coding sequence length (bp)561
Protein length (aa) 187

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00125 Histone Core histone H2A/H2B/H3/H4 1.2E-10 6 54
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 3.7E-09 1 54

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FMV5|NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1 1 81 7.0E-34
sp|Q9SMP0|NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1 1 90 7.0E-34
sp|P79007|HAP5_SCHPO Transcriptional activator hap5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap5 PE=2 SV=1 1 105 8.0E-33
sp|Q8LCG7|NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2 1 71 9.0E-33
sp|Q02516|HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP5 PE=1 SV=1 1 69 9.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FMV5|NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1 1 81 7.0E-34
sp|Q9SMP0|NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1 1 90 7.0E-34
sp|P79007|HAP5_SCHPO Transcriptional activator hap5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap5 PE=2 SV=1 1 105 8.0E-33
sp|Q8LCG7|NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2 1 71 9.0E-33
sp|Q02516|HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP5 PE=1 SV=1 1 69 9.0E-33
sp|Q62725|NFYC_RAT Nuclear transcription factor Y subunit gamma OS=Rattus norvegicus GN=Nfyc PE=2 SV=1 1 71 3.0E-32
sp|P70353|NFYC_MOUSE Nuclear transcription factor Y subunit gamma OS=Mus musculus GN=Nfyc PE=1 SV=2 1 71 3.0E-32
sp|Q5RA23|NFYC_PONAB Nuclear transcription factor Y subunit gamma OS=Pongo abelii GN=NFYC PE=2 SV=1 1 71 3.0E-32
sp|Q5E9X1|NFYC_BOVIN Nuclear transcription factor Y subunit gamma OS=Bos taurus GN=NFYC PE=2 SV=1 1 71 3.0E-32
sp|Q9ZVL3|NFYC3_ARATH Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana GN=NFYC3 PE=2 SV=1 1 100 1.0E-31
sp|Q13952|NFYC_HUMAN Nuclear transcription factor Y subunit gamma OS=Homo sapiens GN=NFYC PE=1 SV=3 1 71 1.0E-31
sp|Q8L4B2|NFYC9_ARATH Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana GN=NFYC9 PE=2 SV=1 1 99 1.0E-30
sp|Q9FGP7|NFYC6_ARATH Nuclear transcription factor Y subunit C-6 OS=Arabidopsis thaliana GN=NFYC6 PE=2 SV=1 1 98 5.0E-29
sp|Q557I1|NFYC_DICDI Nuclear transcription factor Y subunit gamma OS=Dictyostelium discoideum GN=nfyc-1 PE=3 SV=1 1 71 3.0E-26
sp|Q4PSE2|NFYC8_ARATH Nuclear transcription factor Y subunit C-8 OS=Arabidopsis thaliana GN=NFYC8 PE=2 SV=1 1 83 9.0E-22
sp|Q9FGP6|NFYC5_ARATH Nuclear transcription factor Y subunit C-5 OS=Arabidopsis thaliana GN=NFYC5 PE=2 SV=1 1 96 6.0E-21
sp|Q9FGP8|NFYC7_ARATH Nuclear transcription factor Y subunit C-7 OS=Arabidopsis thaliana GN=NFYC7 PE=2 SV=1 1 70 4.0E-19
sp|Q58CM8|NFYCA_ARATH Nuclear transcription factor Y subunit C-10 OS=Arabidopsis thaliana GN=NFYC10 PE=2 SV=1 1 68 1.0E-18
sp|Q9CQ36|DPOE4_MOUSE DNA polymerase epsilon subunit 4 OS=Mus musculus GN=Pole4 PE=1 SV=1 1 63 2.0E-08
sp|Q9NR33|DPOE4_HUMAN DNA polymerase epsilon subunit 4 OS=Homo sapiens GN=POLE4 PE=1 SV=2 1 63 2.0E-08
sp|A6QQ14|DPOE4_BOVIN DNA polymerase epsilon subunit 4 OS=Bos taurus GN=POLE4 PE=3 SV=1 1 63 4.0E-08
sp|Q9NRG0|CHRC1_HUMAN Chromatin accessibility complex protein 1 OS=Homo sapiens GN=CHRAC1 PE=1 SV=1 1 70 6.0E-08
sp|Q9JKP8|CHRC1_MOUSE Chromatin accessibility complex protein 1 OS=Mus musculus GN=Chrac1 PE=1 SV=1 1 70 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3935 0.8397 0.0871 0.0537 0.0167 0.0022 0.1297 0.1231 0.0897 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5125
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1033
Ophiocordyceps australis map64 (Brazil) OphauB2|5024
Ophiocordyceps camponoti-floridani Ophcf2|04266
Ophiocordyceps camponoti-rufipedis Ophun1|343
Ophiocordyceps kimflemingae Ophio5|8494 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3405

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8494
MKADPEVKMISAEAPILFAKGCDIFITELTMRAWIHAEENKRRTLQRSDIASALAKSDMFDFLIDIVPREEASSH
AKRAAAQPSTAATAAIPAPPGQGPLPAQHGNMGQNHSSHPMASSDYMAGHHLATEPDYRQNANMYPSQVPQAPSA
TYGQPQASTSMYGEMEGMYPYTAMQPQQAPMSSEEFE
Coding >Ophio5|8494
ATGAAGGCCGATCCTGAGGTTAAGATGATCTCCGCCGAAGCTCCGATCCTGTTCGCCAAAGGCTGTGATATCTTC
ATCACTGAGTTGACCATGAGGGCATGGATACACGCCGAAGAAAATAAACGTCGTACTCTTCAGCGTTCGGATATT
GCCTCGGCTCTCGCAAAGTCGGACATGTTTGACTTTCTCATTGATATAGTTCCTCGGGAAGAGGCCTCATCCCAT
GCCAAGAGAGCTGCCGCACAACCTTCCACCGCCGCAACCGCGGCCATACCAGCACCTCCTGGTCAAGGTCCATTG
CCAGCTCAACATGGTAACATGGGCCAAAACCATTCCTCGCACCCAATGGCTTCATCGGATTACATGGCGGGCCAC
CACCTCGCGACTGAGCCAGACTACCGCCAAAATGCCAACATGTATCCAAGTCAAGTTCCCCAAGCTCCGTCAGCT
ACCTATGGACAACCCCAGGCATCCACATCCATGTATGGAGAGATGGAGGGAATGTATCCATACACTGCGATGCAA
CCCCAGCAGGCGCCCATGTCCTCGGAGGAATTTGAG
Transcript >Ophio5|8494
ATGAAGGCCGATCCTGAGGTTAAGATGATCTCCGCCGAAGCTCCGATCCTGTTCGCCAAAGGCTGTGATATCTTC
ATCACTGAGTTGACCATGAGGGCATGGATACACGCCGAAGAAAATAAACGTCGTACTCTTCAGCGTTCGGATATT
GCCTCGGCTCTCGCAAAGTCGGACATGTTTGACTTTCTCATTGATATAGTTCCTCGGGAAGAGGCCTCATCCCAT
GCCAAGAGAGCTGCCGCACAACCTTCCACCGCCGCAACCGCGGCCATACCAGCACCTCCTGGTCAAGGTCCATTG
CCAGCTCAACATGGTAACATGGGCCAAAACCATTCCTCGCACCCAATGGCTTCATCGGATTACATGGCGGGCCAC
CACCTCGCGACTGAGCCAGACTACCGCCAAAATGCCAACATGTATCCAAGTCAAGTTCCCCAAGCTCCGTCAGCT
ACCTATGGACAACCCCAGGCATCCACATCCATGTATGGAGAGATGGAGGGAATGTATCCATACACTGCGATGCAA
CCCCAGCAGGCGCCCATGTCCTCGGAGGAATTTGAGTAG
Gene >Ophio5|8494
ATGAAGGCCGATCCTGAGGTTAAGATGATCTCCGCCGAAGCTCCGATCCTGTTCGCCAAAGGCTGTGATATCTTC
ATCACTGAGTTGACCATGAGGGCATGGATACACGCCGAAGAAAATAAACGTCGTACTCTTCAGCGTTCGGATATT
GCCTCGGCTCTCGCAAAGTCGGACATGTTTGACTTTCTCATTGATATAGTTCCTCGGGAAGAGGCCTCATCCCAT
GCCAAGAGAGCTGCCGCACAACCTTCCACCGCCGCAACCGCGGCCATACCAGCACCTCCTGGTCAAGGTCCATTG
CCAGCTCAACATGGTAACATGGGCCAAAACCATTCCTCGCACCCAATGGCTTCATCGGATTACATGGCGGGCCAC
CACCTCGCGACTGAGCCAGACTACCGCCAAAATGCCAACATGTATCCAAGTCAAGTTCCCCAAGCTCCGTCAGCT
ACCTATGGACAACCCCAGGCATCCACATCCATGTATGGAGAGATGGAGGGAATGTATCCATACACTGCGATGCAA
CCCCAGCAGGTCAGTTGAAGCGTACCCCATAGATGGCTGTGCATTTGTTCCTACTCACATTGGCTTAGGCGCCCA
TGTCCTCGGAGGAATTTGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail