Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8488
Gene name
Locationscaffold_952:1838..3106
Strand-
Gene length (bp)1268
Transcript length (bp)789
Coding sequence length (bp)786
Protein length (aa) 262

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01393 Chromo_shadow Chromo shadow domain 9.8E-16 197 251
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 3.6E-12 84 135

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42934|CHP2_SCHPO Chromo domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chp2 PE=3 SV=1 68 252 3.0E-14
sp|P40381|SWI6_SCHPO Chromatin-associated protein swi6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swi6 PE=1 SV=1 196 256 5.0E-14

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1528 0.9466 0.0774 0.025 0.0332 0.0227 0.0097 0.0056 0.0124 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4196
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4650
Ophiocordyceps australis map64 (Brazil) OphauB2|4585
Ophiocordyceps camponoti-floridani Ophcf2|01265
Ophiocordyceps camponoti-rufipedis Ophun1|802
Ophiocordyceps kimflemingae Ophio5|8488 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8528

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8488
MPPALSDDAASDDLEPRPDASLLVDEDDDDEIASEGQAEPMRKMTKAQPKAQATPDDEGEDGDDNGDGDEDEDED
DEDLGEDEFIVEAIKKHMVDEDGSLKFLVKWEGWNKKSDMTWEPEDNLMDSASEILIEYYRQIGGRDSIFEESQV
ASRSKKRGRASTGTATSTKRPRKNGLHPADSTPPASTKKWSPPAGSWEDEIESIDACEDEGSGRLAVYLIWKNGR
KTKHDTSVIYKKCPQKMLQFYEMHVKIIRDENQAAAA
Coding >Ophio5|8488
ATGCCTCCAGCTCTCAGCGACGACGCGGCGTCGGACGACCTCGAGCCCCGGCCTGACGCGTCACTGTTGGTCGAC
GAGGACGATGACGACGAAATCGCCAGTGAAGGTCAAGCTGAGCCTATGCGCAAGATGACCAAGGCTCAGCCCAAG
GCTCAAGCCACGCCCGATGACGAGGGTGAAGATGGTGATGATAACGGTGACGGCGACGAGGACGAGGACGAGGAC
GATGAAGACCTCGGCGAGGATGAGTTCATCGTGGAAGCCATCAAGAAGCACATGGTAGACGAAGACGGTTCCCTG
AAATTTCTGGTCAAGTGGGAAGGGTGGAATAAGAAGTCGGACATGACGTGGGAGCCCGAGGACAACCTAATGGAT
TCGGCGTCGGAGATTTTGATCGAATACTATCGGCAGATCGGTGGGCGCGACAGCATCTTCGAGGAGTCGCAAGTG
GCGTCTCGCAGCAAGAAGCGTGGGCGTGCGTCGACTGGGACGGCGACGTCGACGAAGCGGCCACGGAAGAATGGG
CTGCACCCGGCCGACTCGACGCCGCCGGCGAGTACCAAGAAGTGGAGCCCGCCGGCCGGGTCGTGGGAGGACGAG
ATCGAGTCTATCGACGCGTGCGAGGACGAGGGCAGCGGCAGACTGGCCGTCTATCTGATTTGGAAGAACGGTCGC
AAGACGAAGCACGACACGTCTGTCATTTACAAGAAGTGCCCGCAAAAGATGCTCCAGTTCTACGAGATGCACGTC
AAGATCATTCGCGACGAAAACCAGGCGGCGGCGGCC
Transcript >Ophio5|8488
ATGCCTCCAGCTCTCAGCGACGACGCGGCGTCGGACGACCTCGAGCCCCGGCCTGACGCGTCACTGTTGGTCGAC
GAGGACGATGACGACGAAATCGCCAGTGAAGGTCAAGCTGAGCCTATGCGCAAGATGACCAAGGCTCAGCCCAAG
GCTCAAGCCACGCCCGATGACGAGGGTGAAGATGGTGATGATAACGGTGACGGCGACGAGGACGAGGACGAGGAC
GATGAAGACCTCGGCGAGGATGAGTTCATCGTGGAAGCCATCAAGAAGCACATGGTAGACGAAGACGGTTCCCTG
AAATTTCTGGTCAAGTGGGAAGGGTGGAATAAGAAGTCGGACATGACGTGGGAGCCCGAGGACAACCTAATGGAT
TCGGCGTCGGAGATTTTGATCGAATACTATCGGCAGATCGGTGGGCGCGACAGCATCTTCGAGGAGTCGCAAGTG
GCGTCTCGCAGCAAGAAGCGTGGGCGTGCGTCGACTGGGACGGCGACGTCGACGAAGCGGCCACGGAAGAATGGG
CTGCACCCGGCCGACTCGACGCCGCCGGCGAGTACCAAGAAGTGGAGCCCGCCGGCCGGGTCGTGGGAGGACGAG
ATCGAGTCTATCGACGCGTGCGAGGACGAGGGCAGCGGCAGACTGGCCGTCTATCTGATTTGGAAGAACGGTCGC
AAGACGAAGCACGACACGTCTGTCATTTACAAGAAGTGCCCGCAAAAGATGCTCCAGTTCTACGAGATGCACGTC
AAGATCATTCGCGACGAAAACCAGGCGGCGGCGGCCTAG
Gene >Ophio5|8488
ATGCCTCCAGGTCGGTTTTTCGCCATAGCTCACCGCCTTTTGCCCCCCCTCCCTCTCCGCCTCCCCTCTCACCTC
CCCCCTTGCGCTGCTCTCCTTCGCTTGTTCTCGCTGTGCGGCAACAACACGAAACCCACCTCCCCATTGCCCCCG
CTCGCCCCCCCCCCCAAAGAAAATCACCAGCACATCTGCCCCGTGTCTTGTTCTCGTCGCCCACTTCTTCCGATC
TGCAACCTTGATGGCGCGCAAGCGACGTGTCGCTAAACGCGCTGCAGCTCTCAGCGACGACGCGGCGTCGGACGA
CCTCGAGCCCCGGCCTGACGCGTCACTGTTGGTCGACGAGGACGATGACGACGAAATCGCCAGTGAAGGTCAAGC
TGAGCCTATGCGCAAGATGACCAAGGCTCAGCCCAAGGCTCAAGCCACGCCCGATGACGAGGGTGAAGATGGTGA
TGATAACGGTGACGGCGACGAGGACGAGGACGAGGACGATGAAGACCTCGGCGAGGATGAGTACGATGGCTTGCG
CGCGTGCTTGCAGCTGATGCATACTGACGCGTGGAAGGTTCATCGTGGAAGCCATCAAGAAGCACATGGTAGACG
AAGACGTACGTGTGCGGCCCCGCTGTCCTTGTCGCCGGCGCAGCTGACGGCTCTCTAGGGTTCCCTGAAATTTCT
GGTCAAGTGGGAAGGGTGGAATAAGAAGTCGGACATGACGTGGGAGCCCGAGGACAACCTAATGTGAATGCCAGC
TGTTGCGGCTCGTGACGAGGGCAGCGTCACTGACGTGGCCACAGGGATTCGGCGTCGGAGATTTTGATCGAATAC
TATCGGCAGATCGGTGGGCGCGACAGCATCTTCGAGGAGTCGCAAGTGGCGTCTCGCAGCAAGAAGCGTGGGCGT
GCGTCGACTGGGACGGCGACGTCGACGAAGCGGCCACGGAAGAATGGGCTGCACCCGGCCGACTCGACGCCGCCG
GCGAGTACCAAGAAGTGGAGCCCGCCGGCCGGGTCGTGGGAGGACGAGATCGAGTCTATCGACGCGTGCGAGGAC
GAGGGCAGCGGCAGACTGGCCGTCTATCTGATTTGGAAGAACGGTCGCAAGACGAAGCACGACACGTCTGTCATT
TACAAGAAGTGCCCGCAAAAGGTAGGGAGGGAGGGAGGGAAGGGCCAGCGTTGGAGACGAGGCTGACGGCAGAGC
AGATGCTCCAGTTCTACGAGATGCACGTCAAGATCATTCGCGACGAAAACCAGGCGGCGGCGGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail