Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8487
Gene name
Locationscaffold_951:2329..4795
Strand-
Gene length (bp)2466
Transcript length (bp)2034
Coding sequence length (bp)2031
Protein length (aa) 677

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 1.6E-23 344 497
PF19055 ABC2_membrane_7 ABC-2 type transporter 2.7E-07 527 581

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 3 656 0.0E+00
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 6 586 0.0E+00
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 19 561 2.0E-65
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 342 581 5.0E-58
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 320 580 5.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 3 656 0.0E+00
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 6 586 0.0E+00
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 19 561 2.0E-65
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 342 581 5.0E-58
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 320 580 5.0E-56
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 342 600 1.0E-54
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 342 581 7.0E-54
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 310 606 5.0E-53
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 300 581 9.0E-53
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 342 581 3.0E-52
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 342 581 3.0E-52
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 342 606 4.0E-51
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 342 591 7.0E-51
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 323 587 2.0E-50
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 325 582 3.0E-50
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 315 581 3.0E-50
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 325 581 4.0E-50
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 339 586 6.0E-50
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 339 586 1.0E-49
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 324 581 5.0E-49
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 342 579 7.0E-49
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 312 582 1.0E-48
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 325 581 2.0E-48
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 336 581 2.0E-48
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 321 581 2.0E-48
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 341 581 3.0E-48
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 341 581 7.0E-48
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 350 582 1.0E-47
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 341 581 1.0E-47
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 325 599 1.0E-47
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 350 582 2.0E-47
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 336 581 2.0E-47
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 341 581 4.0E-47
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 350 619 4.0E-47
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 330 581 6.0E-47
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 341 579 9.0E-47
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 327 605 9.0E-47
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 342 651 4.0E-46
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 310 578 5.0E-46
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 341 581 7.0E-46
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 342 579 9.0E-46
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 287 589 2.0E-45
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 338 592 4.0E-45
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 342 581 8.0E-45
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 339 580 1.0E-44
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 339 581 2.0E-44
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 341 581 3.0E-44
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 328 605 4.0E-44
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 341 581 5.0E-44
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 341 581 5.0E-44
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 341 601 5.0E-44
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 325 581 6.0E-44
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 330 634 7.0E-44
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 330 651 1.0E-43
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 342 580 2.0E-43
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 341 581 2.0E-43
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 318 585 7.0E-43
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 330 651 1.0E-42
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 350 580 2.0E-42
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 330 651 5.0E-42
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 311 582 2.0E-41
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 311 582 2.0E-41
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 342 589 2.0E-41
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 320 581 2.0E-41
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 335 581 3.0E-41
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 341 582 3.0E-41
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 342 582 5.0E-41
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 324 559 6.0E-41
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 339 582 7.0E-41
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 353 602 1.0E-40
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 301 626 1.0E-40
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 339 628 1.0E-40
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 299 598 1.0E-40
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 342 600 1.0E-40
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 341 582 2.0E-40
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 275 582 2.0E-40
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 342 579 2.0E-40
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 324 585 2.0E-40
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 318 582 3.0E-40
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 312 582 3.0E-40
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 325 582 3.0E-40
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 328 629 3.0E-40
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 325 556 1.0E-39
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 318 626 1.0E-39
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 325 582 2.0E-39
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 342 581 2.0E-39
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 324 582 3.0E-39
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 335 598 3.0E-39
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 339 582 5.0E-39
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 276 585 6.0E-39
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 342 582 7.0E-39
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 325 582 1.0E-38
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 311 582 1.0E-38
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 310 582 1.0E-38
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 338 585 2.0E-38
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 342 582 3.0E-38
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 342 579 3.0E-38
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 342 582 4.0E-38
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 325 585 4.0E-38
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 325 589 5.0E-38
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 340 625 5.0E-38
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 325 582 8.0E-38
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 325 580 8.0E-38
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 324 582 1.0E-37
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 310 559 1.0E-37
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 342 582 1.0E-37
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 311 585 1.0E-37
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 328 582 2.0E-37
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 308 581 2.0E-37
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 326 581 2.0E-37
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 317 582 3.0E-37
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 342 581 4.0E-37
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 305 582 4.0E-37
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 305 585 7.0E-37
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 326 581 8.0E-37
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 312 582 1.0E-36
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 325 563 1.0E-36
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 324 582 2.0E-36
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 324 552 2.0E-36
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 342 579 2.0E-36
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 325 580 3.0E-36
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 342 582 4.0E-36
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 342 582 4.0E-36
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 324 582 6.0E-36
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 306 582 7.0E-36
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 325 556 2.0E-35
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 342 609 3.0E-35
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 326 582 4.0E-35
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 330 580 4.0E-35
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 298 582 7.0E-35
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 313 582 1.0E-34
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 342 629 1.0E-34
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 324 563 1.0E-34
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 325 552 4.0E-34
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 334 592 1.0E-33
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 340 581 1.0E-33
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 324 554 3.0E-33
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 337 582 4.0E-32
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 341 582 3.0E-31
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 338 582 4.0E-31
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 313 582 5.0E-31
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 338 582 5.0E-30
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 338 581 1.0E-29
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 338 582 2.0E-29
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 338 581 3.0E-29
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 340 582 3.0E-29
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 330 641 3.0E-29
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 333 582 6.0E-29
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 339 582 6.0E-29
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 339 581 5.0E-28
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 340 582 6.0E-28
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 338 582 8.0E-28
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 340 582 1.0E-27
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 340 582 1.0E-27
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 330 601 1.0E-27
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 348 569 1.0E-27
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 339 578 2.0E-27
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 339 582 3.0E-27
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 307 578 4.0E-27
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 339 585 7.0E-27
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 338 578 2.0E-26
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 340 582 2.0E-26
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 340 582 3.0E-26
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 340 582 4.0E-26
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 339 582 4.0E-26
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 340 582 5.0E-26
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 338 582 7.0E-26
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 329 582 1.0E-25
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 338 578 1.0E-25
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 340 582 2.0E-25
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 334 578 2.0E-25
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 337 529 2.0E-25
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 338 582 3.0E-25
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 339 582 3.0E-25
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 338 582 4.0E-25
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 340 582 4.0E-25
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 340 582 5.0E-25
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 340 578 6.0E-25
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 340 582 6.0E-25
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 311 582 6.0E-25
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 339 578 8.0E-25
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 338 582 9.0E-25
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 340 582 1.0E-24
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 340 582 2.0E-24
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 340 582 2.0E-24
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 340 582 2.0E-24
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 339 578 2.0E-24
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 340 582 3.0E-24
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 333 582 6.0E-24
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 340 582 8.0E-24
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 320 582 1.0E-23
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 340 582 1.0E-23
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 340 582 2.0E-23
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 342 582 2.0E-23
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 338 640 3.0E-23
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 340 582 3.0E-23
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 342 582 6.0E-23
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 340 582 1.0E-22
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 342 582 1.0E-22
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 337 529 1.0E-22
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 342 582 2.0E-22
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 309 582 3.0E-22
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 339 582 3.0E-22
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 341 582 3.0E-22
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 338 582 4.0E-22
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 342 582 5.0E-22
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 338 582 5.0E-22
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 339 511 7.0E-22
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 341 566 9.0E-22
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 340 582 2.0E-21
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 328 559 4.0E-21
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 341 557 8.0E-21
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 341 599 2.0E-20
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 339 511 2.0E-20
sp|Q48J29|MODC_PSE14 Molybdenum import ATP-binding protein ModC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=modC PE=3 SV=1 349 562 4.0E-20
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 342 550 9.0E-20
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 339 547 1.0E-19
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 336 582 2.0E-19
sp|Q7W1F4|MODC_BORPA Molybdenum import ATP-binding protein ModC OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=modC PE=3 SV=1 352 562 3.0E-19
sp|Q7WP62|MODC_BORBR Molybdenum import ATP-binding protein ModC OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=modC PE=3 SV=1 352 562 3.0E-19
sp|Q7VUJ5|MODC_BORPE Molybdenum import ATP-binding protein ModC OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=modC PE=3 SV=1 352 562 3.0E-19
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 338 669 4.0E-19
sp|Q881C1|MODC_PSESM Molybdenum import ATP-binding protein ModC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=modC PE=3 SV=1 349 562 5.0E-19
sp|Q3KC21|MODC_PSEPF Molybdenum import ATP-binding protein ModC OS=Pseudomonas fluorescens (strain Pf0-1) GN=modC PE=3 SV=1 352 562 6.0E-19
sp|Q48TC3|PSTB1_STRPM Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pstB1 PE=3 SV=1 328 553 8.0E-19
sp|Q1J6D2|PSTB1_STRPF Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pstB1 PE=3 SV=1 328 553 8.0E-19
sp|Q1JGL3|PSTB1_STRPD Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pstB1 PE=3 SV=1 328 553 8.0E-19
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 326 586 9.0E-19
sp|P0CZ37|PSTB1_STRPQ Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pstB1 PE=3 SV=1 328 553 9.0E-19
sp|P63377|PSTB1_STRP8 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pstB1 PE=3 SV=1 328 553 9.0E-19
sp|P0CZ36|PSTB1_STRP3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pstB1 PE=3 SV=1 328 553 9.0E-19
sp|P63375|PSTB1_STRP1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M1 GN=pstB1 PE=3 SV=1 328 553 9.0E-19
sp|Q5XBY7|PSTB1_STRP6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pstB1 PE=3 SV=2 328 553 9.0E-19
sp|Q1JLH7|PSTB1_STRPC Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pstB1 PE=3 SV=1 328 553 1.0E-18
sp|Q1JBJ5|PSTB1_STRPB Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pstB1 PE=3 SV=1 328 553 1.0E-18
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 320 586 1.0E-18
sp|Q11SW8|LOLD_CYTH3 Lipoprotein-releasing system ATP-binding protein LolD OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lolD PE=3 SV=2 340 546 2.0E-18
sp|P37732|MODC1_AZOVI Molybdenum import ATP-binding protein ModC 1 OS=Azotobacter vinelandii GN=modC1 PE=3 SV=2 352 562 2.0E-18
sp|Q9I2N4|MODC_PSEAE Molybdenum import ATP-binding protein ModC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=modC PE=3 SV=1 349 562 3.0E-18
sp|Q4KB64|MODC_PSEF5 Molybdenum import ATP-binding protein ModC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=modC PE=3 SV=1 352 562 3.0E-18
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 326 553 3.0E-18
sp|Q9HZL7|LOLD_PSEAE Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lolD PE=3 SV=1 320 549 4.0E-18
sp|Q4ZSS5|MODC_PSEU2 Molybdenum import ATP-binding protein ModC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=modC PE=3 SV=1 352 562 4.0E-18
sp|Q74AT2|LOLD_GEOSL Lipoprotein-releasing system ATP-binding protein LolD OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lolD PE=3 SV=1 339 547 8.0E-18
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 331 565 8.0E-18
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 327 566 1.0E-17
sp|P75370|P29_MYCPN Probable ABC transporter ATP-binding protein p29 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=p29 PE=3 SV=1 327 546 1.0E-17
sp|Q63R24|PHNC_BURPS Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain K96243) GN=phnC PE=3 SV=2 327 553 2.0E-17
sp|Q3JNY2|PHNC_BURP1 Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain 1710b) GN=phnC PE=3 SV=1 327 553 2.0E-17
sp|Q6WB63|PHNC_ALCFA Phosphonates import ATP-binding protein PhnC OS=Alcaligenes faecalis GN=phnC PE=3 SV=1 350 593 2.0E-17
sp|Q64Z80|LOLD_BACFR Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain YCH46) GN=lolD PE=3 SV=1 328 549 2.0E-17
sp|Q62H59|PHNC_BURMA Phosphonates import ATP-binding protein PhnC OS=Burkholderia mallei (strain ATCC 23344) GN=phnC PE=3 SV=1 327 553 2.0E-17
sp|Q5LI72|LOLD_BACFN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lolD PE=3 SV=1 328 549 2.0E-17
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 353 563 2.0E-17
sp|Q2RWI9|MODC_RHORT Molybdenum import ATP-binding protein ModC OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=modC PE=3 SV=1 355 568 2.0E-17
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 349 576 2.0E-17
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 328 587 3.0E-17
sp|Q4KFA2|LOLD_PSEF5 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lolD PE=3 SV=2 340 549 3.0E-17
sp|Q83CV2|LOLD_COXBU Lipoprotein-releasing system ATP-binding protein LolD OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lolD PE=3 SV=1 339 547 3.0E-17
sp|Q88G95|MODC_PSEPK Molybdenum import ATP-binding protein ModC OS=Pseudomonas putida (strain KT2440) GN=modC PE=3 SV=1 352 567 3.0E-17
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 343 531 4.0E-17
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 328 549 4.0E-17
sp|Q8XHV3|ECFA2_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA2 PE=3 SV=1 353 582 6.0E-17
sp|Q0TMS8|ECFA2_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA2 PE=3 SV=1 353 582 6.0E-17
sp|Q2L219|LOLD_BORA1 Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella avium (strain 197N) GN=lolD PE=3 SV=1 339 549 6.0E-17
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 321 553 7.0E-17
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 353 548 7.0E-17
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 343 527 7.0E-17
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 341 527 7.0E-17
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 328 586 8.0E-17
sp|Q0HYN8|MODC_SHESR Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-7) GN=modC PE=3 SV=1 355 557 8.0E-17
sp|Q8DPC2|POTA_STRR6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=potA PE=3 SV=1 324 581 8.0E-17
sp|Q97Q42|POTA_STRPN Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=potA PE=3 SV=1 324 581 8.0E-17
sp|Q04JW0|POTA_STRP2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=potA PE=3 SV=1 324 581 8.0E-17
sp|Q0HFA0|MODC_SHESM Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-4) GN=modC PE=3 SV=1 355 557 1.0E-16
sp|Q63SP4|LOLD_BURPS Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia pseudomallei (strain K96243) GN=lolD PE=3 SV=2 340 546 1.0E-16
sp|Q62J04|LOLD_BURMA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia mallei (strain ATCC 23344) GN=lolD PE=3 SV=2 340 546 1.0E-16
sp|Q2J1U0|MODC_RHOP2 Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain HaA2) GN=modC PE=3 SV=1 355 559 1.0E-16
sp|P47705|Y467_MYCGE Putative ABC transporter ATP-binding protein MG467 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG467 PE=3 SV=1 336 549 1.0E-16
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 328 553 1.0E-16
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 326 552 2.0E-16
sp|Q13X01|LOLD_BURXL Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia xenovorans (strain LB400) GN=lolD PE=3 SV=1 325 546 2.0E-16
sp|Q736E0|SSUB_BACC1 Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ssuB PE=3 SV=1 326 544 2.0E-16
sp|Q45460|OPUBA_BACSU Choline transport ATP-binding protein OpuBA OS=Bacillus subtilis (strain 168) GN=opuBA PE=2 SV=2 328 552 2.0E-16
sp|Q0BSM2|LOLD_GRABC Lipoprotein-releasing system ATP-binding protein LolD OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lolD PE=3 SV=1 320 549 2.0E-16
sp|Q8A1M1|LOLD_BACTN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lolD PE=3 SV=1 330 546 2.0E-16
sp|Q2RU16|LOLD1_RHORT Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=lolD1 PE=3 SV=2 327 551 2.0E-16
sp|Q3K9F9|LOLD_PSEPF Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf0-1) GN=lolD PE=3 SV=2 340 546 2.0E-16
sp|Q8EAN3|MODC_SHEON Molybdenum import ATP-binding protein ModC OS=Shewanella oneidensis (strain MR-1) GN=modC PE=3 SV=1 332 612 2.0E-16
sp|O69063|HTXD_PSEST Hypophosphite import ATP-binding protein HtxD OS=Pseudomonas stutzeri GN=htxD PE=3 SV=1 324 571 2.0E-16
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 328 552 3.0E-16
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 328 552 3.0E-16
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 328 552 3.0E-16
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 328 552 3.0E-16
sp|Q47C66|LOLD_DECAR Lipoprotein-releasing system ATP-binding protein LolD OS=Dechloromonas aromatica (strain RCB) GN=lolD PE=3 SV=1 339 546 3.0E-16
sp|Q2SXD1|LOLD_BURTA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lolD PE=3 SV=1 340 546 3.0E-16
sp|Q7MU65|LOLD_PORGI Lipoprotein-releasing system ATP-binding protein LolD OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lolD PE=3 SV=1 332 546 3.0E-16
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 352 533 3.0E-16
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 325 570 4.0E-16
sp|Q46TK4|PHNC_CUPPJ Phosphonates import ATP-binding protein PhnC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=phnC PE=3 SV=1 352 553 4.0E-16
sp|P63374|PSTB1_STRR6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB1 PE=3 SV=1 328 533 4.0E-16
sp|P63373|PSTB1_STRPN Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB1 PE=3 SV=1 328 533 4.0E-16
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 326 560 4.0E-16
sp|Q81C68|SSUB_BACCR Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ssuB PE=3 SV=1 334 544 4.0E-16
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 275 547 4.0E-16
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 354 552 5.0E-16
sp|Q7VKP7|MODC_HAEDU Molybdenum import ATP-binding protein ModC OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=modC PE=3 SV=1 355 549 5.0E-16
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 331 604 5.0E-16
sp|Q9KL34|HMUV_VIBCH Hemin import ATP-binding protein HmuV OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hmuV PE=3 SV=2 333 549 6.0E-16
sp|A0RFA4|SSUB_BACAH Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus thuringiensis (strain Al Hakam) GN=ssuB PE=3 SV=2 317 544 6.0E-16
sp|Q8EB59|HMUV_SHEON Hemin import ATP-binding protein HmuV OS=Shewanella oneidensis (strain MR-1) GN=hmuV PE=3 SV=1 330 552 6.0E-16
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 331 552 6.0E-16
sp|O34992|OPUCA_BACSU Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA OS=Bacillus subtilis (strain 168) GN=opuCA PE=1 SV=1 353 552 7.0E-16
sp|Q8DUF7|POTA_STRMU Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=potA PE=3 SV=1 324 581 7.0E-16
sp|P63368|PSTB1_STRA5 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB1 PE=3 SV=1 328 533 7.0E-16
sp|P63367|PSTB1_STRA3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB1 PE=3 SV=1 328 533 7.0E-16
sp|Q3K199|PSTB1_STRA1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB1 PE=3 SV=2 328 533 7.0E-16
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 339 547 7.0E-16
sp|A3CMQ7|POTA_STRSV Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus sanguinis (strain SK36) GN=potA PE=3 SV=1 324 581 7.0E-16
sp|Q4FTM3|LOLD_PSYA2 Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lolD PE=3 SV=1 342 546 8.0E-16
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 326 552 8.0E-16
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 353 557 8.0E-16
sp|Q608V9|MODC_METCA Molybdenum import ATP-binding protein ModC OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=modC PE=3 SV=1 352 562 9.0E-16
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 327 552 9.0E-16
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 353 553 9.0E-16
sp|Q47CB7|MODC_DECAR Molybdenum import ATP-binding protein ModC OS=Dechloromonas aromatica (strain RCB) GN=modC PE=3 SV=1 352 562 1.0E-15
sp|Q3JDJ6|PSTB1_NITOC Phosphate import ATP-binding protein PstB 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pstB1 PE=3 SV=1 328 572 1.0E-15
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 326 546 1.0E-15
sp|Q180A5|PSTB_PEPD6 Phosphate import ATP-binding protein PstB OS=Peptoclostridium difficile (strain 630) GN=pstB PE=3 SV=1 343 556 1.0E-15
sp|Q6HHI7|SSUB_BACHK Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ssuB PE=3 SV=1 326 544 1.0E-15
sp|Q87UN4|METN2_PSESM Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN2 PE=3 SV=1 353 561 1.0E-15
sp|Q1QCN2|LOLD_PSYCK Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter cryohalolentis (strain K5) GN=lolD PE=3 SV=1 342 546 1.0E-15
sp|Q81P94|SSUB_BACAN Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus anthracis GN=ssuB PE=3 SV=1 340 544 1.0E-15
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 326 561 1.0E-15
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 328 586 1.0E-15
sp|Q7VZ31|LOLD_BORPE Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lolD PE=3 SV=1 339 547 1.0E-15
sp|Q7W8T0|LOLD_BORPA Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lolD PE=3 SV=1 339 547 1.0E-15
sp|Q7WK40|LOLD_BORBR Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lolD PE=3 SV=1 339 547 1.0E-15
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 343 579 1.0E-15
sp|Q5UW69|PHNC2_HALMA Phosphonates import ATP-binding protein PhnC 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=phnC2 PE=3 SV=1 354 553 1.0E-15
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 334 549 1.0E-15
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 326 546 1.0E-15
sp|Q5NZT6|LOLD_AROAE Lipoprotein-releasing system ATP-binding protein LolD OS=Aromatoleum aromaticum (strain EbN1) GN=lolD PE=3 SV=1 338 527 1.0E-15
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 326 546 2.0E-15
sp|Q1LQB5|PHNC1_CUPMC Phosphonates import ATP-binding protein PhnC 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=phnC1 PE=3 SV=2 352 553 2.0E-15
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 326 546 2.0E-15
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 353 586 2.0E-15
sp|Q1BHS6|LOLD_BURCA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia cenocepacia (strain AU 1054) GN=lolD PE=3 SV=1 340 546 2.0E-15
sp|Q39EV3|LOLD_BURL3 Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lolD PE=3 SV=1 340 546 2.0E-15
sp|A0PXX8|ECFA2_CLONN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium novyi (strain NT) GN=ecfA2 PE=3 SV=1 353 592 2.0E-15
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 339 582 2.0E-15
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 322 549 2.0E-15
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 322 549 2.0E-15
sp|Q63A38|SSUB_BACCZ Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ZK / E33L) GN=ssuB PE=3 SV=1 326 544 2.0E-15
sp|O59479|Y1815_PYRHO Putative ABC transporter ATP-binding protein PH1815 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1815 PE=3 SV=1 334 574 2.0E-15
sp|Q48PN3|METN2_PSE14 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN2 PE=3 SV=1 340 557 2.0E-15
sp|Q032D0|PHNC_LACLS Phosphonates import ATP-binding protein PhnC OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=phnC PE=3 SV=1 328 553 2.0E-15
sp|Q39T41|LOLD_GEOMG Lipoprotein-releasing system ATP-binding protein LolD OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lolD PE=3 SV=1 339 549 2.0E-15
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 350 552 2.0E-15
sp|Q2KVK2|METN_BORA1 Methionine import ATP-binding protein MetN OS=Bordetella avium (strain 197N) GN=metN PE=3 SV=1 343 641 2.0E-15
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 324 552 2.0E-15
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 324 552 2.0E-15
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 324 552 2.0E-15
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 324 552 2.0E-15
sp|Q48HL2|PHNC2_PSE14 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=phnC2 PE=3 SV=1 320 528 2.0E-15
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 320 603 3.0E-15
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 352 553 3.0E-15
sp|O66646|LOLD_AQUAE Lipoprotein-releasing system ATP-binding protein LolD OS=Aquifex aeolicus (strain VF5) GN=lolD PE=1 SV=1 331 549 3.0E-15
sp|Q87UV4|METN1_PSESM Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN1 PE=3 SV=2 340 557 3.0E-15
sp|Q1D382|LOLD_MYXXD Lipoprotein-releasing system ATP-binding protein LolD OS=Myxococcus xanthus (strain DK 1622) GN=lolD PE=3 SV=1 334 527 3.0E-15
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 350 552 3.0E-15
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 324 552 3.0E-15
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 324 552 3.0E-15
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 324 552 3.0E-15
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 324 552 3.0E-15
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 324 552 3.0E-15
sp|O31711|YKNY_BACSU Uncharacterized ABC transporter ATP-binding protein YknY OS=Bacillus subtilis (strain 168) GN=yknY PE=1 SV=1 334 549 3.0E-15
sp|Q0A8P9|LOLD_ALKEH Lipoprotein-releasing system ATP-binding protein LolD OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lolD PE=3 SV=1 340 549 3.0E-15
sp|Q3IL62|LOLD_PSEHT Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lolD PE=3 SV=1 338 527 3.0E-15
sp|Q6MD10|LOLD_PARUW Lipoprotein-releasing system ATP-binding protein LolD OS=Protochlamydia amoebophila (strain UWE25) GN=lolD PE=3 SV=1 320 529 3.0E-15
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 324 552 4.0E-15
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 330 583 4.0E-15
sp|Q47YG8|LOLD_COLP3 Lipoprotein-releasing system ATP-binding protein LolD OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lolD PE=3 SV=1 339 576 4.0E-15
sp|Q5NHP2|LOLD_FRATT Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lolD PE=3 SV=1 320 530 4.0E-15
sp|Q2A4V5|LOLD_FRATH Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lolD PE=3 SV=1 320 530 4.0E-15
sp|Q14J44|LOLD_FRAT1 Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lolD PE=3 SV=1 320 530 4.0E-15
sp|Q7VP69|THIQ_HAEDU Thiamine import ATP-binding protein ThiQ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=thiQ PE=3 SV=1 332 549 4.0E-15
sp|Q4ZZR8|METN1_PSEU2 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN1 PE=3 SV=1 353 548 5.0E-15
sp|Q5LS19|PSTB_RUEPO Phosphate import ATP-binding protein PstB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pstB PE=3 SV=2 355 553 5.0E-15
sp|Q6MMY0|LOLD_BDEBA Lipoprotein-releasing system ATP-binding protein LolD OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lolD PE=3 SV=1 334 527 5.0E-15
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 325 561 5.0E-15
sp|Q3BTD3|LOLD_XANC5 Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lolD PE=3 SV=1 353 553 5.0E-15
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 325 561 5.0E-15
sp|Q1AXT9|PSTB_RUBXD Phosphate import ATP-binding protein PstB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pstB PE=3 SV=1 321 527 5.0E-15
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 350 586 5.0E-15
sp|Q47L96|PSTB_THEFY Phosphate import ATP-binding protein PstB OS=Thermobifida fusca (strain YX) GN=pstB PE=3 SV=1 352 553 6.0E-15
sp|Q9V1Q4|Y373_PYRAB Putative ABC transporter ATP-binding protein PYRAB03730 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB03730 PE=3 SV=1 334 574 6.0E-15
sp|A1BE50|MACB_CHLPD Macrolide export ATP-binding/permease protein MacB OS=Chlorobium phaeobacteroides (strain DSM 266) GN=macB PE=3 SV=1 340 565 6.0E-15
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 326 561 6.0E-15
sp|Q6HNE7|RBSA_BACHK Ribose import ATP-binding protein RbsA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rbsA PE=3 SV=1 328 562 6.0E-15
sp|Q81V36|RBSA_BACAN Ribose import ATP-binding protein RbsA OS=Bacillus anthracis GN=rbsA PE=3 SV=2 328 562 6.0E-15
sp|Q82VL9|LOLD_NITEU Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lolD PE=3 SV=1 339 546 6.0E-15
sp|Q6G2E2|METN_BARHE Methionine import ATP-binding protein MetN OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=metN PE=3 SV=1 353 552 6.0E-15
sp|Q9CIQ6|PHNC_LACLA Phosphonates import ATP-binding protein PhnC OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=phnC PE=3 SV=1 328 553 6.0E-15
sp|Q8PKT0|LOLD_XANAC Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lolD PE=3 SV=2 353 553 6.0E-15
sp|Q2LVM2|LOLD_SYNAS Lipoprotein-releasing system ATP-binding protein LolD OS=Syntrophus aciditrophicus (strain SB) GN=lolD PE=3 SV=1 338 549 6.0E-15
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 326 553 6.0E-15
sp|Q63FX9|RBSA_BACCZ Ribose import ATP-binding protein RbsA OS=Bacillus cereus (strain ZK / E33L) GN=rbsA PE=3 SV=1 328 562 6.0E-15
sp|P75612|Y081_MYCPN Putative ABC transporter ATP-binding protein MG065 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_081 PE=3 SV=1 342 547 6.0E-15
sp|Q884I3|LOLD_PSESM Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lolD PE=3 SV=1 340 549 6.0E-15
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 328 549 6.0E-15
sp|Q08381|MODC_RHOCA Molybdenum import ATP-binding protein ModC OS=Rhodobacter capsulatus GN=modC PE=3 SV=1 352 559 6.0E-15
sp|Q0BN75|LOLD_FRATO Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lolD PE=3 SV=1 320 530 6.0E-15
sp|Q88KY4|LOLD_PSEPK Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas putida (strain KT2440) GN=lolD PE=3 SV=2 340 549 6.0E-15
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 330 547 7.0E-15
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 326 546 7.0E-15
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 326 546 7.0E-15
sp|Q1IMC7|PSTB_KORVE Phosphate import ATP-binding protein PstB OS=Koribacter versatilis (strain Ellin345) GN=pstB PE=3 SV=1 326 527 7.0E-15
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 331 548 7.0E-15
sp|Q8UCD5|MODC_AGRFC Molybdenum import ATP-binding protein ModC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=modC PE=3 SV=1 353 566 7.0E-15
sp|P63372|PSTB3_STRA5 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB3 PE=3 SV=1 328 559 7.0E-15
sp|P63371|PSTB3_STRA3 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB3 PE=3 SV=1 328 559 7.0E-15
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 320 553 8.0E-15
sp|Q9KLL9|MODC_VIBCH Molybdenum import ATP-binding protein ModC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=modC PE=3 SV=1 348 559 8.0E-15
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 327 573 8.0E-15
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 332 578 8.0E-15
sp|Q4ZV73|LOLD_PSEU2 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lolD PE=3 SV=2 340 549 8.0E-15
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 353 553 8.0E-15
sp|Q2NHW1|PSTB_METST Phosphate import ATP-binding protein PstB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pstB PE=3 SV=1 331 527 8.0E-15
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 354 553 9.0E-15
sp|Q3J7S3|LOLD_NITOC Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lolD PE=3 SV=1 340 549 9.0E-15
sp|Q8R9I2|PSTB2_CALS4 Phosphate import ATP-binding protein PstB 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB2 PE=3 SV=1 339 557 9.0E-15
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 326 558 9.0E-15
sp|Q21UI2|MODC_RHOFT Molybdenum import ATP-binding protein ModC OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=modC PE=3 SV=1 355 562 9.0E-15
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 326 547 1.0E-14
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 350 552 1.0E-14
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 328 560 1.0E-14
sp|Q882S0|PHNC2_PSESM Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=phnC2 PE=3 SV=1 327 561 1.0E-14
sp|P75186|PSTB_MYCPN Phosphate import ATP-binding protein PstB OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pstB PE=3 SV=1 255 557 1.0E-14
sp|Q9Z8Q8|METN_CHLPN Methionine import ATP-binding protein MetN OS=Chlamydia pneumoniae GN=metN PE=3 SV=1 323 528 1.0E-14
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 353 564 1.0E-14
sp|Q11D92|THIQ_CHESB Thiamine import ATP-binding protein ThiQ OS=Chelativorans sp. (strain BNC1) GN=thiQ PE=3 SV=1 354 578 1.0E-14
sp|Q9EYM2|LOLD_ACIAD Lipoprotein-releasing system ATP-binding protein LolD OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lolD PE=3 SV=1 353 527 1.0E-14
sp|Q3JYY5|PSTB3_STRA1 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB3 PE=3 SV=1 328 549 1.0E-14
sp|Q2W450|LOLD_MAGSA Lipoprotein-releasing system ATP-binding protein LolD OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=lolD PE=3 SV=1 320 549 1.0E-14
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 328 546 1.0E-14
sp|Q32EX7|LOLD_SHIDS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lolD PE=3 SV=2 339 527 1.0E-14
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 353 528 1.0E-14
sp|Q1IKM7|LOLD_KORVE Lipoprotein-releasing system ATP-binding protein LolD OS=Koribacter versatilis (strain Ellin345) GN=lolD PE=3 SV=2 330 546 1.0E-14
sp|Q8P8V9|LOLD_XANCP Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lolD PE=3 SV=2 353 547 1.0E-14
sp|Q4UV71|LOLD_XANC8 Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lolD PE=3 SV=2 353 547 1.0E-14
sp|Q7M8M4|PHNC_WOLSU Phosphonates import ATP-binding protein PhnC OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=phnC PE=3 SV=1 350 566 1.0E-14
sp|Q4ZU82|PHNC2_PSEU2 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=phnC2 PE=3 SV=1 327 528 1.0E-14
sp|Q3Z300|LOLD_SHISS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella sonnei (strain Ss046) GN=lolD PE=3 SV=2 339 527 1.0E-14
sp|Q1RD37|LOLD_ECOUT Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain UTI89 / UPEC) GN=lolD PE=3 SV=1 339 527 1.0E-14
sp|Q8FIM7|LOLD_ECOL6 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lolD PE=3 SV=1 339 527 1.0E-14
sp|Q0TIV6|LOLD_ECOL5 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lolD PE=3 SV=2 339 527 1.0E-14
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 322 525 1.0E-14
sp|Q5M4F2|PSTB2_STRT2 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pstB2 PE=3 SV=1 332 533 1.0E-14
sp|Q5LZU2|PSTB2_STRT1 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pstB2 PE=3 SV=1 332 533 1.0E-14
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 343 592 2.0E-14
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 350 554 2.0E-14
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 350 554 2.0E-14
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 326 546 2.0E-14
sp|Q97EK9|ECFA2_CLOAB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ecfA2 PE=3 SV=1 330 592 2.0E-14
sp|Q1GZH6|LOLD_METFK Lipoprotein-releasing system ATP-binding protein LolD OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lolD PE=3 SV=1 334 527 2.0E-14
sp|Q0SFY5|METN1_RHOJR Methionine import ATP-binding protein MetN 1 OS=Rhodococcus jostii (strain RHA1) GN=metN1 PE=3 SV=1 340 557 2.0E-14
sp|Q8X8E3|LOLD_ECO57 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O157:H7 GN=lolD PE=3 SV=2 339 527 2.0E-14
sp|Q21BF6|MODC_RHOPB Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain BisB18) GN=modC PE=3 SV=1 355 580 2.0E-14
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 330 581 2.0E-14
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 330 581 2.0E-14
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 330 581 2.0E-14
sp|Q9KZW2|PSTB_STRCO Phosphate import ATP-binding protein PstB OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pstB PE=3 SV=1 343 557 2.0E-14
sp|Q38YC1|PSTB2_LACSS Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pstB2 PE=3 SV=1 354 553 2.0E-14
sp|P75957|LOLD_ECOLI Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain K12) GN=lolD PE=1 SV=2 339 527 2.0E-14
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 326 546 2.0E-14
sp|Q9KFL0|PHNC2_BACHD Phosphonates import ATP-binding protein PhnC 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=phnC2 PE=3 SV=2 343 567 2.0E-14
sp|Q72D46|PSTB_DESVH Phosphate import ATP-binding protein PstB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pstB PE=3 SV=1 328 553 2.0E-14
sp|Q5HC57|LOLD_EHRRW Lipoprotein-releasing system ATP-binding protein LolD OS=Ehrlichia ruminantium (strain Welgevonden) GN=lolD PE=3 SV=1 338 527 2.0E-14
sp|Q5FFC0|LOLD_EHRRG Lipoprotein-releasing system ATP-binding protein LolD OS=Ehrlichia ruminantium (strain Gardel) GN=lolD PE=3 SV=2 338 527 2.0E-14
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 353 557 2.0E-14
sp|Q87C88|PSTB_XYLFT Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pstB PE=3 SV=1 325 527 2.0E-14
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 343 578 2.0E-14
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 334 578 2.0E-14
sp|Q9PBK0|PSTB_XYLFA Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain 9a5c) GN=pstB PE=3 SV=1 325 527 2.0E-14
sp|Q2S3A3|LOLD_SALRD Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1 340 535 3.0E-14
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 353 553 3.0E-14
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 328 552 3.0E-14
sp|Q4ZZK0|METN2_PSEU2 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN2 PE=3 SV=1 340 557 3.0E-14
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 325 557 3.0E-14
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 333 547 3.0E-14
sp|Q1GTY0|LOLD_SPHAL Lipoprotein-releasing system ATP-binding protein LolD OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=lolD PE=3 SV=1 340 547 3.0E-14
sp|P0A9U0|YBBA_SHIFL Uncharacterized ABC transporter ATP-binding protein YbbA OS=Shigella flexneri GN=ybbA PE=3 SV=1 338 547 3.0E-14
sp|P0A9T8|YBBA_ECOLI Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli (strain K12) GN=ybbA PE=3 SV=1 338 547 3.0E-14
sp|P0A9T9|YBBA_ECO57 Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli O157:H7 GN=ybbA PE=3 SV=1 338 547 3.0E-14
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 328 552 3.0E-14
sp|Q48KI4|LOLD_PSE14 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lolD PE=3 SV=1 340 549 3.0E-14
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 350 547 3.0E-14
sp|P46920|OPUAA_BACSU Glycine betaine transport ATP-binding protein OpuAA OS=Bacillus subtilis (strain 168) GN=opuAA PE=1 SV=3 353 552 3.0E-14
sp|P63363|PSTB1_LISMO Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB1 PE=3 SV=1 343 553 3.0E-14
sp|Q71WT3|PSTB1_LISMF Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB1 PE=3 SV=1 343 553 3.0E-14
sp|P63364|PSTB1_LISIN Phosphate import ATP-binding protein PstB 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB1 PE=3 SV=1 343 553 3.0E-14
sp|Q81HW8|RBSA_BACCR Ribose import ATP-binding protein RbsA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbsA PE=3 SV=1 328 562 4.0E-14
sp|P36947|RBSA_BACSU Ribose import ATP-binding protein RbsA OS=Bacillus subtilis (strain 168) GN=rbsA PE=3 SV=2 328 557 4.0E-14
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 326 546 4.0E-14
sp|Q3ISC1|PHNC1_NATPD Phosphonates import ATP-binding protein PhnC 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC1 PE=3 SV=1 353 555 4.0E-14
sp|Q21BU8|METN_RHOPB Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB18) GN=metN PE=3 SV=1 353 569 4.0E-14
sp|Q92QN0|LOLD_RHIME Lipoprotein-releasing system ATP-binding protein LolD OS=Rhizobium meliloti (strain 1021) GN=lolD PE=3 SV=1 350 549 4.0E-14
sp|Q6D0F3|THIQ_PECAS Thiamine import ATP-binding protein ThiQ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thiQ PE=3 SV=2 350 558 4.0E-14
sp|Q82G23|PSTB_STRAW Phosphate import ATP-binding protein PstB OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pstB PE=3 SV=1 343 557 4.0E-14
sp|Q748K0|Y3001_GEOSL Putative ABC transporter ATP-binding protein GSU3001 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU3001 PE=3 SV=1 343 553 4.0E-14
sp|Q46ZU5|SSUB_CUPPJ Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ssuB PE=3 SV=1 302 546 4.0E-14
sp|Q6AMR9|LOLD_DESPS Lipoprotein-releasing system ATP-binding protein LolD OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lolD PE=3 SV=1 355 546 4.0E-14
sp|Q7VV72|METN_BORPE Methionine import ATP-binding protein MetN OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metN PE=3 SV=1 328 552 4.0E-14
sp|Q7W4E1|METN_BORPA Methionine import ATP-binding protein MetN OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metN PE=3 SV=1 328 552 4.0E-14
sp|Q7WFU9|METN_BORBR Methionine import ATP-binding protein MetN OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metN PE=3 SV=1 328 552 4.0E-14
sp|Q8EEV5|LOLD_SHEON Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella oneidensis (strain MR-1) GN=lolD PE=3 SV=1 341 546 4.0E-14
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 328 559 4.0E-14
sp|Q2JPW6|PHNC1_SYNJB Phosphonates import ATP-binding protein PhnC 1 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC1 PE=3 SV=1 353 559 4.0E-14
sp|Q2GE91|LOLD_NEOSM Lipoprotein-releasing system ATP-binding protein LolD OS=Neorickettsia sennetsu (strain Miyayama) GN=lolD PE=3 SV=1 326 529 4.0E-14
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 350 547 4.0E-14
sp|Q49WM4|POTA_STAS1 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=potA PE=3 SV=1 328 581 4.0E-14
sp|A0LM36|MACB_SYNFM Macrolide export ATP-binding/permease protein MacB OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=macB PE=3 SV=1 334 529 4.0E-14
sp|Q0SVB6|PSTB_CLOPS Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain SM101 / Type A) GN=pstB PE=3 SV=1 330 553 4.0E-14
sp|Q8XMP8|PSTB_CLOPE Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain 13 / Type A) GN=pstB PE=3 SV=1 330 553 4.0E-14
sp|Q0TTG6|PSTB_CLOP1 Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pstB PE=3 SV=1 330 553 4.0E-14
sp|Q3ATR5|MACB_CHLCH Macrolide export ATP-binding/permease protein MacB OS=Chlorobium chlorochromatii (strain CaD3) GN=macB PE=3 SV=1 334 549 4.0E-14
sp|Q8U242|PSTB_PYRFU Phosphate import ATP-binding protein PstB OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pstB PE=3 SV=1 355 553 4.0E-14
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 326 546 4.0E-14
sp|Q8RGC8|FBPC_FUSNN Fe(3+) ions import ATP-binding protein FbpC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fbpC PE=3 SV=1 350 578 5.0E-14
sp|Q2IYS5|PHNC1_RHOP2 Phosphonates import ATP-binding protein PhnC 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=phnC1 PE=3 SV=2 353 555 5.0E-14
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 353 557 5.0E-14
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 326 561 5.0E-14
sp|Q9EUS2|PSTB_STRGR Phosphate import ATP-binding protein PstB OS=Streptomyces griseus GN=pstB PE=3 SV=1 343 557 5.0E-14
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 327 560 5.0E-14
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 339 527 5.0E-14
sp|Q8ZX91|PSTB_PYRAE Phosphate import ATP-binding protein PstB OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pstB PE=3 SV=1 332 557 5.0E-14
sp|Q5H0G3|LOLD_XANOR Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lolD PE=3 SV=1 353 553 5.0E-14
sp|Q2P3E1|LOLD_XANOM Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lolD PE=3 SV=1 353 553 5.0E-14
sp|Q5F8K2|LOLD_NEIG1 Lipoprotein-releasing system ATP-binding protein LolD OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lolD PE=3 SV=1 350 546 5.0E-14
sp|Q7NTU0|LOLD_CHRVO Lipoprotein-releasing system ATP-binding protein LolD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lolD PE=3 SV=1 340 555 5.0E-14
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 326 546 5.0E-14
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 328 552 6.0E-14
sp|P55662|Y4TH_RHISN Probable amino-acid ABC transporter ATP-binding protein y4tH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01510 PE=3 SV=1 328 539 6.0E-14
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 350 554 6.0E-14
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 326 559 6.0E-14
sp|Q1QX72|LOLD_CHRSD Lipoprotein-releasing system ATP-binding protein LolD OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lolD PE=3 SV=2 340 547 6.0E-14
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 327 560 7.0E-14
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 350 594 7.0E-14
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 327 560 7.0E-14
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 327 560 7.0E-14
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 327 560 7.0E-14
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 327 560 7.0E-14
sp|Q5M397|POTA_STRT2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=potA PE=3 SV=1 330 581 7.0E-14
sp|Q5LYN4|POTA_STRT1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain CNRZ 1066) GN=potA PE=3 SV=1 330 581 7.0E-14
sp|Q1RK34|LOLD_RICBR Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia bellii (strain RML369-C) GN=lolD PE=3 SV=1 328 546 7.0E-14
sp|Q03JH1|POTA_STRTD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=potA PE=3 SV=1 330 581 8.0E-14
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 327 560 8.0E-14
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 330 552 8.0E-14
sp|Q9AT00|TGD3_ARATH Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic OS=Arabidopsis thaliana GN=TGD3 PE=1 SV=1 332 552 8.0E-14
sp|Q9HNI8|PHNC_HALSA Phosphonates import ATP-binding protein PhnC OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=phnC PE=3 SV=1 332 552 8.0E-14
sp|Q31J97|HMUV_THICR Hemin import ATP-binding protein HmuV OS=Thiomicrospira crunogena (strain XCL-2) GN=hmuV PE=3 SV=1 342 552 8.0E-14
sp|Q9CEW8|PSTB1_LACLA Phosphate import ATP-binding protein PstB 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pstB1 PE=3 SV=1 323 561 8.0E-14
sp|Q4W575|FBPC_NEIMB Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbpC PE=3 SV=1 327 573 8.0E-14
sp|Q9JVH1|FBPC_NEIMA Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbpC PE=3 SV=1 327 573 8.0E-14
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 320 552 8.0E-14
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 320 552 8.0E-14
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 320 552 8.0E-14
sp|Q21Y06|PHNC2_RHOFT Phosphonates import ATP-binding protein PhnC 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=phnC2 PE=3 SV=1 350 557 8.0E-14
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 395 581 9.0E-14
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 323 573 9.0E-14
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 339 553 9.0E-14
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 352 556 9.0E-14
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 353 557 2.0E-10
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 346 511 2.0E-08
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 340 582 3.0E-07
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 353 565 6.0E-07
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 444 552 1.0E-06
sp|Q81HW8|RBSA_BACCR Ribose import ATP-binding protein RbsA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbsA PE=3 SV=1 330 548 2.0E-06
sp|Q6HNE7|RBSA_BACHK Ribose import ATP-binding protein RbsA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rbsA PE=3 SV=1 330 548 9.0E-06
sp|Q81V36|RBSA_BACAN Ribose import ATP-binding protein RbsA OS=Bacillus anthracis GN=rbsA PE=3 SV=2 330 548 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0022804 active transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0043167 ion binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0030554 adenyl nucleotide binding No
GO:0022857 transmembrane transporter activity No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 274 296 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 218.32 100.41 336.23
CcL In ants, during behavior modification 137.92 67.99 207.84
CcD In ants, recently dead 100.27 52.14 148.40

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.080527 no
SC16a CcD 0.001647 yes
CcL CcD 0.213364 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8487
MGGRPDHCPPCFNCLLPAHTCSQYASCNEYNGKCECPAGFGGDDCLEPLCGSLARGKDRPMRSGAACECDGGWAG
INCNVCTNNEACDALMETGNGGVCYQNGEVVNNNHQMCRVTNKQITTLLGKQVPEVTFGCQKKASECNFQFWVDA
VESFFCHLTECQSGANFDEAKNTTSYKCGQIRCSCIPGRMLCGKDGSVDLSDFLKQSIRGPGSFECIYNKRGSHD
CAFSEPEMDKLIHQLIGDSSILLDCQPGECLYETEVPGYQRPVKQINTPLIASVIAACALFVVALIILTWFRSRR
KLKYGAIRLEDSDDEATKLMNDHKPVALYFENVSYSLNQINILSQIQGICRPGEVTAIMGASGAGKTTFLDILAR
KNKRGQVSGNFFVNGEGVSDSEFKNVVGFVDQEDAMLPTLTVHETILNSALLRLPRDMSRLAKEQRAFEVEKELG
IYHIRDSLVGSEDGSGRGISGGEKRRVGIACELVTSPSILFLDEPTSGLDSFNAYNVVECLVTLAKNYKRTIIFT
IHQPRSNIVALFDRLILLAQGKTVYSGPFSQCQSYFDTTGYQCPPGFNIADYLVDLTMHAGTSIPVDDGTNTADA
ASVGPSSTKAVKSVASMSGASTGEDSNPDWYSGLPRSRFGDSETRGQYRRLIGRRRRGNRSEIADSIREEIRQAP
IC
Coding >Ophio5|8487
ATGGGCGGCCGTCCTGATCACTGCCCTCCTTGTTTCAACTGCCTACTTCCAGCTCACACCTGCTCTCAATACGCC
AGCTGCAACGAGTATAATGGGAAATGCGAGTGCCCTGCTGGGTTTGGAGGGGACGATTGTCTCGAACCTTTATGC
GGCTCACTCGCCCGCGGCAAGGACAGGCCCATGCGATCCGGCGCGGCTTGTGAATGTGATGGCGGTTGGGCTGGC
ATCAATTGCAACGTCTGCACGAATAATGAAGCGTGCGATGCCTTGATGGAGACCGGCAACGGGGGTGTTTGCTAT
CAGAATGGCGAGGTTGTCAACAATAACCACCAGATGTGCAGGGTTACGAACAAGCAGATCACGACTCTTCTTGGG
AAGCAAGTTCCTGAAGTGACATTCGGCTGCCAAAAGAAGGCGTCTGAATGTAACTTTCAATTTTGGGTTGATGCC
GTTGAGTCCTTCTTCTGTCATCTCACCGAATGCCAATCCGGCGCAAACTTTGACGAGGCGAAGAACACGACGTCT
TACAAATGTGGGCAGATCAGGTGCAGCTGCATCCCAGGGCGCATGCTGTGCGGCAAAGATGGCTCCGTTGATCTC
AGCGACTTTCTCAAGCAATCGATTCGGGGTCCGGGCAGCTTTGAATGCATCTATAACAAGCGCGGATCCCACGAT
TGTGCTTTTTCGGAACCCGAAATGGACAAACTCATTCATCAGCTCATTGGCGATTCCAGCATCCTTTTGGATTGT
CAACCGGGCGAATGCTTGTATGAGACCGAGGTGCCTGGCTATCAGCGTCCGGTCAAACAAATCAACACTCCCCTC
ATTGCTAGTGTCATCGCGGCATGCGCTCTTTTCGTCGTTGCCCTCATCATACTGACCTGGTTTCGTTCGCGCCGC
AAACTCAAATACGGGGCAATCCGCTTGGAAGATTCTGACGACGAGGCAACCAAGCTGATGAACGACCACAAACCA
GTAGCCCTTTATTTCGAGAACGTCTCGTATTCTCTGAATCAAATCAACATACTCAGCCAAATTCAGGGCATATGT
CGTCCCGGGGAGGTGACGGCCATCATGGGTGCGTCTGGTGCTGGGAAGACGACTTTTCTCGACATCCTGGCTCGG
AAGAACAAGCGCGGCCAAGTCTCTGGCAATTTTTTCGTTAACGGTGAAGGAGTCAGCGATTCGGAGTTCAAAAAT
GTCGTGGGGTTTGTGGATCAAGAAGATGCCATGCTCCCCACGCTCACTGTGCACGAGACGATCCTCAACAGCGCA
CTTCTGCGACTGCCGCGAGACATGAGTCGCCTTGCCAAAGAGCAGAGGGCATTTGAGGTGGAGAAAGAGTTGGGA
ATCTACCACATTCGGGACTCGCTCGTTGGCTCCGAAGACGGCAGTGGCCGCGGGATATCTGGTGGCGAGAAACGA
CGAGTGGGAATCGCCTGCGAGCTTGTAACAAGCCCCTCGATTCTCTTTCTCGACGAACCCACAAGCGGACTGGAT
TCTTTCAACGCTTACAACGTGGTTGAATGCCTCGTCACTCTAGCGAAAAACTATAAAAGGACCATTATCTTCACC
ATTCACCAACCTCGGTCCAATATCGTGGCGCTTTTCGATCGACTAATACTTTTAGCTCAGGGCAAAACGGTCTAT
TCAGGTCCATTTTCTCAATGCCAATCGTACTTCGACACAACGGGCTACCAATGCCCGCCTGGGTTCAACATAGCC
GACTACCTCGTCGATCTCACAATGCATGCGGGAACTAGCATACCTGTCGACGACGGAACCAACACCGCCGACGCG
GCGAGCGTTGGCCCAAGCAGCACCAAAGCGGTCAAGTCGGTGGCCAGCATGTCGGGGGCCAGCACAGGAGAGGAC
AGCAATCCCGACTGGTATTCCGGCCTGCCCAGAAGCCGGTTTGGCGACTCTGAAACGCGTGGCCAATACCGCCGC
CTCATCGGACGCCGGCGGCGAGGAAACCGGTCCGAAATTGCCGACAGCATCCGTGAGGAGATAAGGCAGGCTCCC
ATCTGT
Transcript >Ophio5|8487
ATGGGCGGCCGTCCTGATCACTGCCCTCCTTGTTTCAACTGCCTACTTCCAGCTCACACCTGCTCTCAATACGCC
AGCTGCAACGAGTATAATGGGAAATGCGAGTGCCCTGCTGGGTTTGGAGGGGACGATTGTCTCGAACCTTTATGC
GGCTCACTCGCCCGCGGCAAGGACAGGCCCATGCGATCCGGCGCGGCTTGTGAATGTGATGGCGGTTGGGCTGGC
ATCAATTGCAACGTCTGCACGAATAATGAAGCGTGCGATGCCTTGATGGAGACCGGCAACGGGGGTGTTTGCTAT
CAGAATGGCGAGGTTGTCAACAATAACCACCAGATGTGCAGGGTTACGAACAAGCAGATCACGACTCTTCTTGGG
AAGCAAGTTCCTGAAGTGACATTCGGCTGCCAAAAGAAGGCGTCTGAATGTAACTTTCAATTTTGGGTTGATGCC
GTTGAGTCCTTCTTCTGTCATCTCACCGAATGCCAATCCGGCGCAAACTTTGACGAGGCGAAGAACACGACGTCT
TACAAATGTGGGCAGATCAGGTGCAGCTGCATCCCAGGGCGCATGCTGTGCGGCAAAGATGGCTCCGTTGATCTC
AGCGACTTTCTCAAGCAATCGATTCGGGGTCCGGGCAGCTTTGAATGCATCTATAACAAGCGCGGATCCCACGAT
TGTGCTTTTTCGGAACCCGAAATGGACAAACTCATTCATCAGCTCATTGGCGATTCCAGCATCCTTTTGGATTGT
CAACCGGGCGAATGCTTGTATGAGACCGAGGTGCCTGGCTATCAGCGTCCGGTCAAACAAATCAACACTCCCCTC
ATTGCTAGTGTCATCGCGGCATGCGCTCTTTTCGTCGTTGCCCTCATCATACTGACCTGGTTTCGTTCGCGCCGC
AAACTCAAATACGGGGCAATCCGCTTGGAAGATTCTGACGACGAGGCAACCAAGCTGATGAACGACCACAAACCA
GTAGCCCTTTATTTCGAGAACGTCTCGTATTCTCTGAATCAAATCAACATACTCAGCCAAATTCAGGGCATATGT
CGTCCCGGGGAGGTGACGGCCATCATGGGTGCGTCTGGTGCTGGGAAGACGACTTTTCTCGACATCCTGGCTCGG
AAGAACAAGCGCGGCCAAGTCTCTGGCAATTTTTTCGTTAACGGTGAAGGAGTCAGCGATTCGGAGTTCAAAAAT
GTCGTGGGGTTTGTGGATCAAGAAGATGCCATGCTCCCCACGCTCACTGTGCACGAGACGATCCTCAACAGCGCA
CTTCTGCGACTGCCGCGAGACATGAGTCGCCTTGCCAAAGAGCAGAGGGCATTTGAGGTGGAGAAAGAGTTGGGA
ATCTACCACATTCGGGACTCGCTCGTTGGCTCCGAAGACGGCAGTGGCCGCGGGATATCTGGTGGCGAGAAACGA
CGAGTGGGAATCGCCTGCGAGCTTGTAACAAGCCCCTCGATTCTCTTTCTCGACGAACCCACAAGCGGACTGGAT
TCTTTCAACGCTTACAACGTGGTTGAATGCCTCGTCACTCTAGCGAAAAACTATAAAAGGACCATTATCTTCACC
ATTCACCAACCTCGGTCCAATATCGTGGCGCTTTTCGATCGACTAATACTTTTAGCTCAGGGCAAAACGGTCTAT
TCAGGTCCATTTTCTCAATGCCAATCGTACTTCGACACAACGGGCTACCAATGCCCGCCTGGGTTCAACATAGCC
GACTACCTCGTCGATCTCACAATGCATGCGGGAACTAGCATACCTGTCGACGACGGAACCAACACCGCCGACGCG
GCGAGCGTTGGCCCAAGCAGCACCAAAGCGGTCAAGTCGGTGGCCAGCATGTCGGGGGCCAGCACAGGAGAGGAC
AGCAATCCCGACTGGTATTCCGGCCTGCCCAGAAGCCGGTTTGGCGACTCTGAAACGCGTGGCCAATACCGCCGC
CTCATCGGACGCCGGCGGCGAGGAAACCGGTCCGAAATTGCCGACAGCATCCGTGAGGAGATAAGGCAGGCTCCC
ATCTGTTGA
Gene >Ophio5|8487
ATGGGCGGCCGTCCTGATCACTGCCCTCCTTGGTAGGAATACGGAATCTTCGGTTAATAGCGTTTGATGAGATCG
CTTTCCTGACGGGACGAGACTCAGTTTCAACTGCCTACTTCCAGCTCACACCTGCTCTCAATACGCCAGCTGCAA
CGAGTATAATGGGAAATGCGAGTGCCCTGCTGGGTTTGGAGGGGACGATTGTCTCGAACCTTGTATGTTTTCACG
CCGATATCAGCATCAAACCCATTCCCATAGCCACGAGCCCGCGGATCATGATTACTGATTCGCGCCCAGTATGCG
GCTCACTCGCCCGCGGCAAGGACAGGCCCATGCGATCCGGCGCGGCTTGTGAATGTGATGGCGGTTGGGCTGGCA
TCAATTGCAACGTCTGCACGAATAATGAAGCGTGCGATGCCTTGATGGAGACCGGCAACGGGGGTGTTTGCTATC
AGAATGGCGAGGTTGTCAACAATAACCACCAGATGTGCAGGGTTACGAACAAGCAGATCACGACTCTTCTTGGGA
AGCAAGTTCCTGAAGTGACATTCGGCTGCCAAAAGAAGGCGTCTGAATGTAACTTTCAATGTAAGTTTTGCATAA
GCCATTGAGATCGCAATGAGGTCAATACTCACGCGGGTGTTATCTTCCAGTTTGGGTTGATGCCGTTGAGTCCTT
CTTCTGTCATCTCACCGAATGCCAATCCGGCGCAAACTTTGACGAGGCGAAGAACACGACGTCTTACAAATGTGG
GCAGATCAGGTGCAGCTGCATCCCAGGGCGCATGCTGTGCGGCAAAGATGGCTCCGTTGATCTCAGCGACTTTCT
CAAGCAATCGATTCGGGGTCCGGGCAGCTTTGAATGCATCTATAACAAGCGCGGATCCCACGATTGTGCTTTTTC
GGAACCCGAAATGGACAAACTCATTCATCAGCTCATTGGCGATTCCAGCATCCTTTTGGATTGTCAACCGGGCGA
ATGCTTGTATGAGACCGAGGTGCCTGGCTATCAGCGTCCGGTCAAACAAATCAACACTCCCCTCATTGCTAGTGT
CATCGCGGCATGCGCTCTTTTCGTCGTTGCCCTCATCATACTGACCTGGTTTCGTTCGCGCCGCAAACTCAAATA
CGGGGCAATCCGCTTGGAAGATTCTGACGACGAGGCAACCAAGCTGATGAACGACCACAAACCAGTAGCCCTTTA
TTTCGAGAACGTCTCGTATTCTCTGAATCAAATCAACATACTCAGCCAAATTCAGGGCATATGTCGTCCCGGGGA
GGTGACGGCCATCATGGGTGCGTCTGGTGCTGGGAAGACGACTTTTCTCGACATCCTGGCTCGGAAGAACAAGCG
CGGCCAAGTCTCTGGCAATTTTTTCGTTAACGGTGAAGGAGTCAGCGATTCGGAGTTCAAAAATGTCGTGGGGTT
TGTGGATCAAGAAGATGCCATGCTCCCCACGCTCACTGTGCACGAGACGATCCTCAACAGCGCACTTCTGCGACT
GCCGCGAGACATGAGTCGCCTTGCCAAAGAGCAGAGGGCATTTGAGGTGGAGAAAGAGTTGGGAATCTACCACAT
TCGGGACTCGCTCGTTGGCTCCGAAGACGGCAGTGGCCGCGGGATATCTGGTGGCGAGAAACGACGAGTGGGAAT
CGCCTGCGAGCTTGTAACAAGCCCCTCGATTCTCTTTCTCGACGAACCCACAAGCGGACTGGATTCTTTCAACGC
TTACAACGTGGTTGAATGCCTCGTCACTCTAGCGAAAAACTATAAAAGGACCATTATCTTCACCATTCACCAACC
TCGGTCCAATATCGTGGCGCTTTTCGATCGACTAATACTTTTAGCTCAGGGCAAAACGGTCTATTCAGGTCCATT
TTCTCAATGCCAATCGTACTTCGACACAACGGGCTACCAATGCCCGCCTGGGTTCAACATAGCCGACTACCTCGT
CGATCTCACAATGCATGCGGGAACTAGCATACCTGTCGACGACGGAACCAACACCGCCGACGCGGCGAGCGTTGG
CCCAAGCAGCACCAAAGCGGTCAAGTCGGTGGCCAGCATGTCGGGGGCCAGCACAGGAGAGGACAGCAATCCCGA
CTGGTATTCCGGCCTGCCCAGAAGCCGGTTTGGCGACTCTGTCAGGACTCGTCAGGAGCGAGAGCTATTCACACG
CAGGAAACGCGTGGCCAATACCGCCGCCTCATCGGACGCCGGCGGCGAGGAAACCGGTGCGTATCGTCTTCGGGT
CAACCCAGCCGCTTACGGTACGATATCACAGCCAGCGGACGACAGATACGCACTGCCACTGGCTGCAGATACAGG
TACTGACCTGGACCTCATGACACAATCTTTCGCTAGGTCCGAAATTGCCGACAGCATCCGTGAGGAGATAAGGCA
GGCTGTGAGCACGGCCAATGAAGCTAATCGGCAAAATGACATTGACGCAGCCAGCCCATCTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail