Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8487
Gene name
Locationscaffold_951:2329..4795
Strand-
Gene length (bp)2466
Transcript length (bp)2034
Coding sequence length (bp)2031
Protein length (aa) 677

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 1.6E-23 344 497
PF19055 ABC2_membrane_7 ABC-2 type transporter 2.7E-07 527 581

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 3 656 0.0E+00
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 6 586 0.0E+00
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 19 561 2.0E-65
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 342 581 5.0E-58
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 320 580 5.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 3 656 0.0E+00
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 6 586 0.0E+00
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 19 561 2.0E-65
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 342 581 5.0E-58
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 320 580 5.0E-56
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 342 600 1.0E-54
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 342 581 7.0E-54
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 310 606 5.0E-53
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 300 581 9.0E-53
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 342 581 3.0E-52
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 342 581 3.0E-52
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 342 606 4.0E-51
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 342 591 7.0E-51
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 323 587 2.0E-50
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 325 582 3.0E-50
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 315 581 3.0E-50
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 325 581 4.0E-50
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 339 586 6.0E-50
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 339 586 1.0E-49
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 324 581 5.0E-49
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 342 579 7.0E-49
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 312 582 1.0E-48
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 325 581 2.0E-48
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 336 581 2.0E-48
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 321 581 2.0E-48
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 341 581 3.0E-48
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 341 581 7.0E-48
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 350 582 1.0E-47
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 341 581 1.0E-47
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 325 599 1.0E-47
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 350 582 2.0E-47
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 336 581 2.0E-47
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 341 581 4.0E-47
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 350 619 4.0E-47
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 330 581 6.0E-47
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 341 579 9.0E-47
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 327 605 9.0E-47
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 342 651 4.0E-46
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 310 578 5.0E-46
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 341 581 7.0E-46
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 342 579 9.0E-46
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 287 589 2.0E-45
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 338 592 4.0E-45
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 342 581 8.0E-45
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 339 580 1.0E-44
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 339 581 2.0E-44
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 341 581 3.0E-44
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 328 605 4.0E-44
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 341 581 5.0E-44
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 341 581 5.0E-44
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 341 601 5.0E-44
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 325 581 6.0E-44
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 330 634 7.0E-44
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 330 651 1.0E-43
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 342 580 2.0E-43
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 341 581 2.0E-43
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 318 585 7.0E-43
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 330 651 1.0E-42
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 350 580 2.0E-42
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 330 651 5.0E-42
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 311 582 2.0E-41
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 311 582 2.0E-41
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 342 589 2.0E-41
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 320 581 2.0E-41
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 335 581 3.0E-41
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 341 582 3.0E-41
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 342 582 5.0E-41
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 324 559 6.0E-41
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 339 582 7.0E-41
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 353 602 1.0E-40
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 301 626 1.0E-40
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 339 628 1.0E-40
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 299 598 1.0E-40
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 342 600 1.0E-40
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 341 582 2.0E-40
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 275 582 2.0E-40
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 342 579 2.0E-40
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 324 585 2.0E-40
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 318 582 3.0E-40
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 312 582 3.0E-40
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 325 582 3.0E-40
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 328 629 3.0E-40
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 325 556 1.0E-39
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 318 626 1.0E-39
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 325 582 2.0E-39
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 342 581 2.0E-39
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 324 582 3.0E-39
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 335 598 3.0E-39
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 339 582 5.0E-39
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 276 585 6.0E-39
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 342 582 7.0E-39
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 325 582 1.0E-38
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 311 582 1.0E-38
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 310 582 1.0E-38
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 338 585 2.0E-38
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 342 582 3.0E-38
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 342 579 3.0E-38
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 342 582 4.0E-38
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 325 585 4.0E-38
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 325 589 5.0E-38
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 340 625 5.0E-38
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 325 582 8.0E-38
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 325 580 8.0E-38
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 324 582 1.0E-37
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 310 559 1.0E-37
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 342 582 1.0E-37
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 311 585 1.0E-37
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 328 582 2.0E-37
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 308 581 2.0E-37
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 326 581 2.0E-37
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 317 582 3.0E-37
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 342 581 4.0E-37
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 305 582 4.0E-37
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 305 585 7.0E-37
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 326 581 8.0E-37
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 312 582 1.0E-36
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 325 563 1.0E-36
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 324 582 2.0E-36
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 324 552 2.0E-36
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 342 579 2.0E-36
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 325 580 3.0E-36
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 342 582 4.0E-36
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 342 582 4.0E-36
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 324 582 6.0E-36
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 306 582 7.0E-36
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 325 556 2.0E-35
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 342 609 3.0E-35
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 326 582 4.0E-35
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 330 580 4.0E-35
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 298 582 7.0E-35
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 313 582 1.0E-34
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 342 629 1.0E-34
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 324 563 1.0E-34
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 325 552 4.0E-34
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 334 592 1.0E-33
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 340 581 1.0E-33
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 324 554 3.0E-33
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 337 582 4.0E-32
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 341 582 3.0E-31
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 338 582 4.0E-31
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 313 582 5.0E-31
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 338 582 5.0E-30
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 338 581 1.0E-29
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 338 582 2.0E-29
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 338 581 3.0E-29
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 340 582 3.0E-29
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 330 641 3.0E-29
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 333 582 6.0E-29
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 339 582 6.0E-29
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 339 581 5.0E-28
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 340 582 6.0E-28
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 338 582 8.0E-28
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 340 582 1.0E-27
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 340 582 1.0E-27
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 330 601 1.0E-27
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 348 569 1.0E-27
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 339 578 2.0E-27
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 339 582 3.0E-27
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 307 578 4.0E-27
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 339 585 7.0E-27
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 338 578 2.0E-26
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 340 582 2.0E-26
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 340 582 3.0E-26
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 340 582 4.0E-26
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 339 582 4.0E-26
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 340 582 5.0E-26
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 338 582 7.0E-26
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 329 582 1.0E-25
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 338 578 1.0E-25
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 340 582 2.0E-25
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 334 578 2.0E-25
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 337 529 2.0E-25
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 338 582 3.0E-25
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 339 582 3.0E-25
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 338 582 4.0E-25
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 340 582 4.0E-25
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 340 582 5.0E-25
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 340 578 6.0E-25
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 340 582 6.0E-25
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 311 582 6.0E-25
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 339 578 8.0E-25
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 338 582 9.0E-25
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 340 582 1.0E-24
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 340 582 2.0E-24
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 340 582 2.0E-24
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 340 582 2.0E-24
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 339 578 2.0E-24
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 340 582 3.0E-24
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 333 582 6.0E-24
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 340 582 8.0E-24
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 320 582 1.0E-23
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 340 582 1.0E-23
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 340 582 2.0E-23
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 342 582 2.0E-23
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 338 640 3.0E-23
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 340 582 3.0E-23
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 342 582 6.0E-23
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 340 582 1.0E-22
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 342 582 1.0E-22
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 337 529 1.0E-22
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 342 582 2.0E-22
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 309 582 3.0E-22
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 339 582 3.0E-22
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 341 582 3.0E-22
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 338 582 4.0E-22
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 342 582 5.0E-22
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 338 582 5.0E-22
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 339 511 7.0E-22
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 341 566 9.0E-22
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 340 582 2.0E-21
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 328 559 4.0E-21
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 341 557 8.0E-21
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 341 599 2.0E-20
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 339 511 2.0E-20
sp|Q48J29|MODC_PSE14 Molybdenum import ATP-binding protein ModC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=modC PE=3 SV=1 349 562 4.0E-20
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 342 550 9.0E-20
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 339 547 1.0E-19
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 336 582 2.0E-19
sp|Q7W1F4|MODC_BORPA Molybdenum import ATP-binding protein ModC OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=modC PE=3 SV=1 352 562 3.0E-19
sp|Q7WP62|MODC_BORBR Molybdenum import ATP-binding protein ModC OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=modC PE=3 SV=1 352 562 3.0E-19
sp|Q7VUJ5|MODC_BORPE Molybdenum import ATP-binding protein ModC OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=modC PE=3 SV=1 352 562 3.0E-19
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 338 669 4.0E-19
sp|Q881C1|MODC_PSESM Molybdenum import ATP-binding protein ModC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=modC PE=3 SV=1 349 562 5.0E-19
sp|Q3KC21|MODC_PSEPF Molybdenum import ATP-binding protein ModC OS=Pseudomonas fluorescens (strain Pf0-1) GN=modC PE=3 SV=1 352 562 6.0E-19
sp|Q48TC3|PSTB1_STRPM Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pstB1 PE=3 SV=1 328 553 8.0E-19
sp|Q1J6D2|PSTB1_STRPF Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pstB1 PE=3 SV=1 328 553 8.0E-19
sp|Q1JGL3|PSTB1_STRPD Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pstB1 PE=3 SV=1 328 553 8.0E-19
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 326 586 9.0E-19
sp|P0CZ37|PSTB1_STRPQ Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pstB1 PE=3 SV=1 328 553 9.0E-19
sp|P63377|PSTB1_STRP8 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pstB1 PE=3 SV=1 328 553 9.0E-19
sp|P0CZ36|PSTB1_STRP3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pstB1 PE=3 SV=1 328 553 9.0E-19
sp|P63375|PSTB1_STRP1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M1 GN=pstB1 PE=3 SV=1 328 553 9.0E-19
sp|Q5XBY7|PSTB1_STRP6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pstB1 PE=3 SV=2 328 553 9.0E-19
sp|Q1JLH7|PSTB1_STRPC Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pstB1 PE=3 SV=1 328 553 1.0E-18
sp|Q1JBJ5|PSTB1_STRPB Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pstB1 PE=3 SV=1 328 553 1.0E-18
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 320 586 1.0E-18
sp|Q11SW8|LOLD_CYTH3 Lipoprotein-releasing system ATP-binding protein LolD OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lolD PE=3 SV=2 340 546 2.0E-18
sp|P37732|MODC1_AZOVI Molybdenum import ATP-binding protein ModC 1 OS=Azotobacter vinelandii GN=modC1 PE=3 SV=2 352 562 2.0E-18
sp|Q9I2N4|MODC_PSEAE Molybdenum import ATP-binding protein ModC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=modC PE=3 SV=1 349 562 3.0E-18
sp|Q4KB64|MODC_PSEF5 Molybdenum import ATP-binding protein ModC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=modC PE=3 SV=1 352 562 3.0E-18
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 326 553 3.0E-18
sp|Q9HZL7|LOLD_PSEAE Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lolD PE=3 SV=1 320 549 4.0E-18
sp|Q4ZSS5|MODC_PSEU2 Molybdenum import ATP-binding protein ModC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=modC PE=3 SV=1 352 562 4.0E-18
sp|Q74AT2|LOLD_GEOSL Lipoprotein-releasing system ATP-binding protein LolD OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lolD PE=3 SV=1 339 547 8.0E-18
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 331 565 8.0E-18
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 327 566 1.0E-17
sp|P75370|P29_MYCPN Probable ABC transporter ATP-binding protein p29 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=p29 PE=3 SV=1 327 546 1.0E-17
sp|Q63R24|PHNC_BURPS Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain K96243) GN=phnC PE=3 SV=2 327 553 2.0E-17
sp|Q3JNY2|PHNC_BURP1 Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain 1710b) GN=phnC PE=3 SV=1 327 553 2.0E-17
sp|Q6WB63|PHNC_ALCFA Phosphonates import ATP-binding protein PhnC OS=Alcaligenes faecalis GN=phnC PE=3 SV=1 350 593 2.0E-17
sp|Q64Z80|LOLD_BACFR Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain YCH46) GN=lolD PE=3 SV=1 328 549 2.0E-17
sp|Q62H59|PHNC_BURMA Phosphonates import ATP-binding protein PhnC OS=Burkholderia mallei (strain ATCC 23344) GN=phnC PE=3 SV=1 327 553 2.0E-17
sp|Q5LI72|LOLD_BACFN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lolD PE=3 SV=1 328 549 2.0E-17
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 353 563 2.0E-17
sp|Q2RWI9|MODC_RHORT Molybdenum import ATP-binding protein ModC OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=modC PE=3 SV=1 355 568 2.0E-17
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 349 576 2.0E-17
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 328 587 3.0E-17
sp|Q4KFA2|LOLD_PSEF5 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lolD PE=3 SV=2 340 549 3.0E-17
sp|Q83CV2|LOLD_COXBU Lipoprotein-releasing system ATP-binding protein LolD OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lolD PE=3 SV=1 339 547 3.0E-17
sp|Q88G95|MODC_PSEPK Molybdenum import ATP-binding protein ModC OS=Pseudomonas putida (strain KT2440) GN=modC PE=3 SV=1 352 567 3.0E-17
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 343 531 4.0E-17
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 328 549 4.0E-17
sp|Q8XHV3|ECFA2_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA2 PE=3 SV=1 353 582 6.0E-17
sp|Q0TMS8|ECFA2_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA2 PE=3 SV=1 353 582 6.0E-17
sp|Q2L219|LOLD_BORA1 Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella avium (strain 197N) GN=lolD PE=3 SV=1 339 549 6.0E-17
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 321 553 7.0E-17
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 353 548 7.0E-17
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 343 527 7.0E-17
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 341 527 7.0E-17
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 328 586 8.0E-17
sp|Q0HYN8|MODC_SHESR Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-7) GN=modC PE=3 SV=1 355 557 8.0E-17
sp|Q8DPC2|POTA_STRR6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=potA PE=3 SV=1 324 581 8.0E-17
sp|Q97Q42|POTA_STRPN Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=potA PE=3 SV=1 324 581 8.0E-17
sp|Q04JW0|POTA_STRP2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=potA PE=3 SV=1 324 581 8.0E-17
sp|Q0HFA0|MODC_SHESM Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-4) GN=modC PE=3 SV=1 355 557 1.0E-16
sp|Q63SP4|LOLD_BURPS Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia pseudomallei (strain K96243) GN=lolD PE=3 SV=2 340 546 1.0E-16
sp|Q62J04|LOLD_BURMA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia mallei (strain ATCC 23344) GN=lolD PE=3 SV=2 340 546 1.0E-16
sp|Q2J1U0|MODC_RHOP2 Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain HaA2) GN=modC PE=3 SV=1 355 559 1.0E-16
sp|P47705|Y467_MYCGE Putative ABC transporter ATP-binding protein MG467 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG467 PE=3 SV=1 336 549 1.0E-16
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 328 553 1.0E-16
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 326 552 2.0E-16
sp|Q13X01|LOLD_BURXL Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia xenovorans (strain LB400) GN=lolD PE=3 SV=1 325 546 2.0E-16
sp|Q736E0|SSUB_BACC1 Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ssuB PE=3 SV=1 326 544 2.0E-16
sp|Q45460|OPUBA_BACSU Choline transport ATP-binding protein OpuBA OS=Bacillus subtilis (strain 168) GN=opuBA PE=2 SV=2 328 552 2.0E-16
sp|Q0BSM2|LOLD_GRABC Lipoprotein-releasing system ATP-binding protein LolD OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lolD PE=3 SV=1 320 549 2.0E-16
sp|Q8A1M1|LOLD_BACTN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lolD PE=3 SV=1 330 546 2.0E-16
sp|Q2RU16|LOLD1_RHORT Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=lolD1 PE=3 SV=2 327 551 2.0E-16
sp|Q3K9F9|LOLD_PSEPF Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf0-1) GN=lolD PE=3 SV=2 340 546 2.0E-16
sp|Q8EAN3|MODC_SHEON Molybdenum import ATP-binding protein ModC OS=Shewanella oneidensis (strain MR-1) GN=modC PE=3 SV=1 332 612 2.0E-16
sp|O69063|HTXD_PSEST Hypophosphite import ATP-binding protein HtxD OS=Pseudomonas stutzeri GN=htxD PE=3 SV=1 324 571 2.0E-16
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 328 552 3.0E-16
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 328 552 3.0E-16
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 328 552 3.0E-16
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 328 552 3.0E-16
sp|Q47C66|LOLD_DECAR Lipoprotein-releasing system ATP-binding protein LolD OS=Dechloromonas aromatica (strain RCB) GN=lolD PE=3 SV=1 339 546 3.0E-16
sp|Q2SXD1|LOLD_BURTA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lolD PE=3 SV=1 340 546 3.0E-16
sp|Q7MU65|LOLD_PORGI Lipoprotein-releasing system ATP-binding protein LolD OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lolD PE=3 SV=1 332 546 3.0E-16
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 352 533 3.0E-16
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 325 570 4.0E-16
sp|Q46TK4|PHNC_CUPPJ Phosphonates import ATP-binding protein PhnC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=phnC PE=3 SV=1 352 553 4.0E-16
sp|P63374|PSTB1_STRR6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB1 PE=3 SV=1 328 533 4.0E-16
sp|P63373|PSTB1_STRPN Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB1 PE=3 SV=1 328 533 4.0E-16
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 326 560 4.0E-16
sp|Q81C68|SSUB_BACCR Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ssuB PE=3 SV=1 334 544 4.0E-16
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 275 547 4.0E-16
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 354 552 5.0E-16
sp|Q7VKP7|MODC_HAEDU Molybdenum import ATP-binding protein ModC OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=modC PE=3 SV=1 355 549 5.0E-16
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 331 604 5.0E-16
sp|Q9KL34|HMUV_VIBCH Hemin import ATP-binding protein HmuV OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hmuV PE=3 SV=2 333 549 6.0E-16
sp|A0RFA4|SSUB_BACAH Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus thuringiensis (strain Al Hakam) GN=ssuB PE=3 SV=2 317 544 6.0E-16
sp|Q8EB59|HMUV_SHEON Hemin import ATP-binding protein HmuV OS=Shewanella oneidensis (strain MR-1) GN=hmuV PE=3 SV=1 330 552 6.0E-16
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 331 552 6.0E-16
sp|O34992|OPUCA_BACSU Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA OS=Bacillus subtilis (strain 168) GN=opuCA PE=1 SV=1 353 552 7.0E-16
sp|Q8DUF7|POTA_STRMU Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=potA PE=3 SV=1 324 581 7.0E-16
sp|P63368|PSTB1_STRA5 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB1 PE=3 SV=1 328 533 7.0E-16
sp|P63367|PSTB1_STRA3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB1 PE=3 SV=1 328 533 7.0E-16
sp|Q3K199|PSTB1_STRA1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB1 PE=3 SV=2 328 533 7.0E-16
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 339 547 7.0E-16
sp|A3CMQ7|POTA_STRSV Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus sanguinis (strain SK36) GN=potA PE=3 SV=1 324 581 7.0E-16
sp|Q4FTM3|LOLD_PSYA2 Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lolD PE=3 SV=1 342 546 8.0E-16
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 326 552 8.0E-16
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 353 557 8.0E-16
sp|Q608V9|MODC_METCA Molybdenum import ATP-binding protein ModC OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=modC PE=3 SV=1 352 562 9.0E-16
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 327 552 9.0E-16
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 353 553 9.0E-16
sp|Q47CB7|MODC_DECAR Molybdenum import ATP-binding protein ModC OS=Dechloromonas aromatica (strain RCB) GN=modC PE=3 SV=1 352 562 1.0E-15
sp|Q3JDJ6|PSTB1_NITOC Phosphate import ATP-binding protein PstB 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pstB1 PE=3 SV=1 328 572 1.0E-15
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 326 546 1.0E-15
sp|Q180A5|PSTB_PEPD6 Phosphate import ATP-binding protein PstB OS=Peptoclostridium difficile (strain 630) GN=pstB PE=3 SV=1 343 556 1.0E-15
sp|Q6HHI7|SSUB_BACHK Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ssuB PE=3 SV=1 326 544 1.0E-15
sp|Q87UN4|METN2_PSESM Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN2 PE=3 SV=1 353 561 1.0E-15
sp|Q1QCN2|LOLD_PSYCK Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter cryohalolentis (strain K5) GN=lolD PE=3 SV=1 342 546 1.0E-15
sp|Q81P94|SSUB_BACAN Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus anthracis GN=ssuB PE=3 SV=1 340 544 1.0E-15
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 326 561 1.0E-15
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 328 586 1.0E-15
sp|Q7VZ31|LOLD_BORPE Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lolD PE=3 SV=1 339 547 1.0E-15
sp|Q7W8T0|LOLD_BORPA Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lolD PE=3 SV=1 339 547 1.0E-15
sp|Q7WK40|LOLD_BORBR Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lolD PE=3 SV=1 339 547 1.0E-15
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 343 579 1.0E-15
sp|Q5UW69|PHNC2_HALMA Phosphonates import ATP-binding protein PhnC 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=phnC2 PE=3 SV=1 354 553 1.0E-15
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 334 549 1.0E-15
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 326 546 1.0E-15
sp|Q5NZT6|LOLD_AROAE Lipoprotein-releasing system ATP-binding protein LolD OS=Aromatoleum aromaticum (strain EbN1) GN=lolD PE=3 SV=1 338 527 1.0E-15
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 326 546 2.0E-15
sp|Q1LQB5|PHNC1_CUPMC Phosphonates import ATP-binding protein PhnC 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=phnC1 PE=3 SV=2 352 553 2.0E-15
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 326 546 2.0E-15
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 353 586 2.0E-15
sp|Q1BHS6|LOLD_BURCA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia cenocepacia (strain AU 1054) GN=lolD PE=3 SV=1 340 546 2.0E-15
sp|Q39EV3|LOLD_BURL3 Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lolD PE=3 SV=1 340 546 2.0E-15
sp|A0PXX8|ECFA2_CLONN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium novyi (strain NT) GN=ecfA2 PE=3 SV=1 353 592 2.0E-15
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 339 582 2.0E-15
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 322 549 2.0E-15
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 322 549 2.0E-15
sp|Q63A38|SSUB_BACCZ Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ZK / E33L) GN=ssuB PE=3 SV=1 326 544 2.0E-15
sp|O59479|Y1815_PYRHO Putative ABC transporter ATP-binding protein PH1815 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1815 PE=3 SV=1 334 574 2.0E-15
sp|Q48PN3|METN2_PSE14 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN2 PE=3 SV=1 340 557 2.0E-15
sp|Q032D0|PHNC_LACLS Phosphonates import ATP-binding protein PhnC OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=phnC PE=3 SV=1 328 553 2.0E-15
sp|Q39T41|LOLD_GEOMG Lipoprotein-releasing system ATP-binding protein LolD OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lolD PE=3 SV=1 339 549 2.0E-15
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 350 552 2.0E-15
sp|Q2KVK2|METN_BORA1 Methionine import ATP-binding protein MetN OS=Bordetella avium (strain 197N) GN=metN PE=3 SV=1 343 641 2.0E-15
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 324 552 2.0E-15
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 324 552 2.0E-15
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 324 552 2.0E-15
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 324 552 2.0E-15
sp|Q48HL2|PHNC2_PSE14 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=phnC2 PE=3 SV=1 320 528 2.0E-15
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 320 603 3.0E-15
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 352 553 3.0E-15
sp|O66646|LOLD_AQUAE Lipoprotein-releasing system ATP-binding protein LolD OS=Aquifex aeolicus (strain VF5) GN=lolD PE=1 SV=1 331 549 3.0E-15
sp|Q87UV4|METN1_PSESM Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN1 PE=3 SV=2 340 557 3.0E-15
sp|Q1D382|LOLD_MYXXD Lipoprotein-releasing system ATP-binding protein LolD OS=Myxococcus xanthus (strain DK 1622) GN=lolD PE=3 SV=1 334 527 3.0E-15
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 350 552 3.0E-15
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 324 552 3.0E-15
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 324 552 3.0E-15
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 324 552 3.0E-15
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 324 552 3.0E-15
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 324 552 3.0E-15
sp|O31711|YKNY_BACSU Uncharacterized ABC transporter ATP-binding protein YknY OS=Bacillus subtilis (strain 168) GN=yknY PE=1 SV=1 334 549 3.0E-15
sp|Q0A8P9|LOLD_ALKEH Lipoprotein-releasing system ATP-binding protein LolD OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lolD PE=3 SV=1 340 549 3.0E-15
sp|Q3IL62|LOLD_PSEHT Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lolD PE=3 SV=1 338 527 3.0E-15
sp|Q6MD10|LOLD_PARUW Lipoprotein-releasing system ATP-binding protein LolD OS=Protochlamydia amoebophila (strain UWE25) GN=lolD PE=3 SV=1 320 529 3.0E-15
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 324 552 4.0E-15
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 330 583 4.0E-15
sp|Q47YG8|LOLD_COLP3 Lipoprotein-releasing system ATP-binding protein LolD OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lolD PE=3 SV=1 339 576 4.0E-15
sp|Q5NHP2|LOLD_FRATT Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lolD PE=3 SV=1 320 530 4.0E-15
sp|Q2A4V5|LOLD_FRATH Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lolD PE=3 SV=1 320 530 4.0E-15
sp|Q14J44|LOLD_FRAT1 Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lolD PE=3 SV=1 320 530 4.0E-15
sp|Q7VP69|THIQ_HAEDU Thiamine import ATP-binding protein ThiQ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=thiQ PE=3 SV=1 332 549 4.0E-15
sp|Q4ZZR8|METN1_PSEU2 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN1 PE=3 SV=1 353 548 5.0E-15
sp|Q5LS19|PSTB_RUEPO Phosphate import ATP-binding protein PstB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pstB PE=3 SV=2 355 553 5.0E-15
sp|Q6MMY0|LOLD_BDEBA Lipoprotein-releasing system ATP-binding protein LolD OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lolD PE=3 SV=1 334 527 5.0E-15
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 325 561 5.0E-15
sp|Q3BTD3|LOLD_XANC5 Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lolD PE=3 SV=1 353 553 5.0E-15
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 325 561 5.0E-15
sp|Q1AXT9|PSTB_RUBXD Phosphate import ATP-binding protein PstB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pstB PE=3 SV=1 321 527 5.0E-15
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 350 586 5.0E-15
sp|Q47L96|PSTB_THEFY Phosphate import ATP-binding protein PstB OS=Thermobifida fusca (strain YX) GN=pstB PE=3 SV=1 352 553 6.0E-15
sp|Q9V1Q4|Y373_PYRAB Putative ABC transporter ATP-binding protein PYRAB03730 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB03730 PE=3 SV=1 334 574 6.0E-15
sp|A1BE50|MACB_CHLPD Macrolide export ATP-binding/permease protein MacB OS=Chlorobium phaeobacteroides (strain DSM 266) GN=macB PE=3 SV=1 340 565 6.0E-15
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 326 561 6.0E-15
sp|Q6HNE7|RBSA_BACHK Ribose import ATP-binding protein RbsA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rbsA PE=3 SV=1 328 562 6.0E-15
sp|Q81V36|RBSA_BACAN Ribose import ATP-binding protein RbsA OS=Bacillus anthracis GN=rbsA PE=3 SV=2 328 562 6.0E-15
sp|Q82VL9|LOLD_NITEU Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lolD PE=3 SV=1 339 546 6.0E-15
sp|Q6G2E2|METN_BARHE Methionine import ATP-binding protein MetN OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=metN PE=3 SV=1 353 552 6.0E-15
sp|Q9CIQ6|PHNC_LACLA Phosphonates import ATP-binding protein PhnC OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=phnC PE=3 SV=1 328 553 6.0E-15
sp|Q8PKT0|LOLD_XANAC Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lolD PE=3 SV=2 353 553 6.0E-15
sp|Q2LVM2|LOLD_SYNAS Lipoprotein-releasing system ATP-binding protein LolD OS=Syntrophus aciditrophicus (strain SB) GN=lolD PE=3 SV=1 338 549 6.0E-15
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 326 553 6.0E-15
sp|Q63FX9|RBSA_BACCZ Ribose import ATP-binding protein RbsA OS=Bacillus cereus (strain ZK / E33L) GN=rbsA PE=3 SV=1 328 562 6.0E-15
sp|P75612|Y081_MYCPN Putative ABC transporter ATP-binding protein MG065 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_081 PE=3 SV=1 342 547 6.0E-15
sp|Q884I3|LOLD_PSESM Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lolD PE=3 SV=1 340 549 6.0E-15
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 328 549 6.0E-15
sp|Q08381|MODC_RHOCA Molybdenum import ATP-binding protein ModC OS=Rhodobacter capsulatus GN=modC PE=3 SV=1 352 559 6.0E-15
sp|Q0BN75|LOLD_FRATO Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lolD PE=3 SV=1 320 530 6.0E-15
sp|Q88KY4|LOLD_PSEPK Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas putida (strain KT2440) GN=lolD PE=3 SV=2 340 549 6.0E-15
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 330 547 7.0E-15
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 326 546 7.0E-15
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 326 546 7.0E-15
sp|Q1IMC7|PSTB_KORVE Phosphate import ATP-binding protein PstB OS=Koribacter versatilis (strain Ellin345) GN=pstB PE=3 SV=1 326 527 7.0E-15
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 331 548 7.0E-15
sp|Q8UCD5|MODC_AGRFC Molybdenum import ATP-binding protein ModC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=modC PE=3 SV=1 353 566 7.0E-15
sp|P63372|PSTB3_STRA5 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB3 PE=3 SV=1 328 559 7.0E-15
sp|P63371|PSTB3_STRA3 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB3 PE=3 SV=1 328 559 7.0E-15
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 320 553 8.0E-15
sp|Q9KLL9|MODC_VIBCH Molybdenum import ATP-binding protein ModC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=modC PE=3 SV=1 348 559 8.0E-15
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 327 573 8.0E-15
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 332 578 8.0E-15
sp|Q4ZV73|LOLD_PSEU2 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lolD PE=3 SV=2 340 549 8.0E-15
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 353 553 8.0E-15
sp|Q2NHW1|PSTB_METST Phosphate import ATP-binding protein PstB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pstB PE=3 SV=1 331 527 8.0E-15
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 354 553 9.0E-15
sp|Q3J7S3|LOLD_NITOC Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lolD PE=3 SV=1 340 549 9.0E-15
sp|Q8R9I2|PSTB2_CALS4 Phosphate import ATP-binding protein PstB 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB2 PE=3 SV=1 339 557 9.0E-15
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 326 558 9.0E-15
sp|Q21UI2|MODC_RHOFT Molybdenum import ATP-binding protein ModC OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=modC PE=3 SV=1 355 562 9.0E-15
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 326 547 1.0E-14
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 350 552 1.0E-14
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 328 560 1.0E-14
sp|Q882S0|PHNC2_PSESM Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=phnC2 PE=3 SV=1 327 561 1.0E-14
sp|P75186|PSTB_MYCPN Phosphate import ATP-binding protein PstB OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pstB PE=3 SV=1 255 557 1.0E-14
sp|Q9Z8Q8|METN_CHLPN Methionine import ATP-binding protein MetN OS=Chlamydia pneumoniae GN=metN PE=3 SV=1 323 528 1.0E-14
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 353 564 1.0E-14
sp|Q11D92|THIQ_CHESB Thiamine import ATP-binding protein ThiQ OS=Chelativorans sp. (strain BNC1) GN=thiQ PE=3 SV=1 354 578 1.0E-14
sp|Q9EYM2|LOLD_ACIAD Lipoprotein-releasing system ATP-binding protein LolD OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lolD PE=3 SV=1 353 527 1.0E-14
sp|Q3JYY5|PSTB3_STRA1 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB3 PE=3 SV=1 328 549 1.0E-14
sp|Q2W450|LOLD_MAGSA Lipoprotein-releasing system ATP-binding protein LolD OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=lolD PE=3 SV=1 320 549 1.0E-14
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 328 546 1.0E-14
sp|Q32EX7|LOLD_SHIDS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lolD PE=3 SV=2 339 527 1.0E-14
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 353 528 1.0E-14
sp|Q1IKM7|LOLD_KORVE Lipoprotein-releasing system ATP-binding protein LolD OS=Koribacter versatilis (strain Ellin345) GN=lolD PE=3 SV=2 330 546 1.0E-14
sp|Q8P8V9|LOLD_XANCP Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lolD PE=3 SV=2 353 547 1.0E-14
sp|Q4UV71|LOLD_XANC8 Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lolD PE=3 SV=2 353 547 1.0E-14
sp|Q7M8M4|PHNC_WOLSU Phosphonates import ATP-binding protein PhnC OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=phnC PE=3 SV=1 350 566 1.0E-14
sp|Q4ZU82|PHNC2_PSEU2 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=phnC2 PE=3 SV=1 327 528 1.0E-14
sp|Q3Z300|LOLD_SHISS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella sonnei (strain Ss046) GN=lolD PE=3 SV=2 339 527 1.0E-14
sp|Q1RD37|LOLD_ECOUT Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain UTI89 / UPEC) GN=lolD PE=3 SV=1 339 527 1.0E-14
sp|Q8FIM7|LOLD_ECOL6 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lolD PE=3 SV=1 339 527 1.0E-14
sp|Q0TIV6|LOLD_ECOL5 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lolD PE=3 SV=2 339 527 1.0E-14
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 322 525 1.0E-14
sp|Q5M4F2|PSTB2_STRT2 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pstB2 PE=3 SV=1 332 533 1.0E-14
sp|Q5LZU2|PSTB2_STRT1 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pstB2 PE=3 SV=1 332 533 1.0E-14
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 343 592 2.0E-14
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 350 554 2.0E-14
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 350 554 2.0E-14
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 326 546 2.0E-14
sp|Q97EK9|ECFA2_CLOAB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ecfA2 PE=3 SV=1 330 592 2.0E-14
sp|Q1GZH6|LOLD_METFK Lipoprotein-releasing system ATP-binding protein LolD OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lolD PE=3 SV=1 334 527 2.0E-14
sp|Q0SFY5|METN1_RHOJR Methionine import ATP-binding protein MetN 1 OS=Rhodococcus jostii (strain RHA1) GN=metN1 PE=3 SV=1 340 557 2.0E-14
sp|Q8X8E3|LOLD_ECO57 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O157:H7 GN=lolD PE=3 SV=2 339 527 2.0E-14
sp|Q21BF6|MODC_RHOPB Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain BisB18) GN=modC PE=3 SV=1 355 580 2.0E-14
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 330 581 2.0E-14
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 330 581 2.0E-14
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 330 581 2.0E-14
sp|Q9KZW2|PSTB_STRCO Phosphate import ATP-binding protein PstB OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pstB PE=3 SV=1 343 557 2.0E-14
sp|Q38YC1|PSTB2_LACSS Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pstB2 PE=3 SV=1 354 553 2.0E-14
sp|P75957|LOLD_ECOLI Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain K12) GN=lolD PE=1 SV=2 339 527 2.0E-14
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 326 546 2.0E-14
sp|Q9KFL0|PHNC2_BACHD Phosphonates import ATP-binding protein PhnC 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=phnC2 PE=3 SV=2 343 567 2.0E-14
sp|Q72D46|PSTB_DESVH Phosphate import ATP-binding protein PstB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pstB PE=3 SV=1 328 553 2.0E-14
sp|Q5HC57|LOLD_EHRRW Lipoprotein-releasing system ATP-binding protein LolD OS=Ehrlichia ruminantium (strain Welgevonden) GN=lolD PE=3 SV=1 338 527 2.0E-14
sp|Q5FFC0|LOLD_EHRRG Lipoprotein-releasing system ATP-binding protein LolD OS=Ehrlichia ruminantium (strain Gardel) GN=lolD PE=3 SV=2 338 527 2.0E-14
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 353 557 2.0E-14
sp|Q87C88|PSTB_XYLFT Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pstB PE=3 SV=1 325 527 2.0E-14
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 343 578 2.0E-14
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 334 578 2.0E-14
sp|Q9PBK0|PSTB_XYLFA Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain 9a5c) GN=pstB PE=3 SV=1 325 527 2.0E-14
sp|Q2S3A3|LOLD_SALRD Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1 340 535 3.0E-14
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 353 553 3.0E-14
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 328 552 3.0E-14
sp|Q4ZZK0|METN2_PSEU2 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN2 PE=3 SV=1 340 557 3.0E-14
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 325 557 3.0E-14
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 333 547 3.0E-14
sp|Q1GTY0|LOLD_SPHAL Lipoprotein-releasing system ATP-binding protein LolD OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=lolD PE=3 SV=1 340 547 3.0E-14
sp|P0A9U0|YBBA_SHIFL Uncharacterized ABC transporter ATP-binding protein YbbA OS=Shigella flexneri GN=ybbA PE=3 SV=1 338 547 3.0E-14
sp|P0A9T8|YBBA_ECOLI Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli (strain K12) GN=ybbA PE=3 SV=1 338 547 3.0E-14
sp|P0A9T9|YBBA_ECO57 Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli O157:H7 GN=ybbA PE=3 SV=1 338 547 3.0E-14
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 328 552 3.0E-14
sp|Q48KI4|LOLD_PSE14 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lolD PE=3 SV=1 340 549 3.0E-14
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 350 547 3.0E-14
sp|P46920|OPUAA_BACSU Glycine betaine transport ATP-binding protein OpuAA OS=Bacillus subtilis (strain 168) GN=opuAA PE=1 SV=3 353 552 3.0E-14
sp|P63363|PSTB1_LISMO Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB1 PE=3 SV=1 343 553 3.0E-14
sp|Q71WT3|PSTB1_LISMF Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB1 PE=3 SV=1 343 553 3.0E-14
sp|P63364|PSTB1_LISIN Phosphate import ATP-binding protein PstB 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB1 PE=3 SV=1 343 553 3.0E-14
sp|Q81HW8|RBSA_BACCR Ribose import ATP-binding protein RbsA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbsA PE=3 SV=1 328 562 4.0E-14
sp|P36947|RBSA_BACSU Ribose import ATP-binding protein RbsA OS=Bacillus subtilis (strain 168) GN=rbsA PE=3 SV=2 328 557 4.0E-14
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 326 546 4.0E-14
sp|Q3ISC1|PHNC1_NATPD Phosphonates import ATP-binding protein PhnC 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC1 PE=3 SV=1 353 555 4.0E-14
sp|Q21BU8|METN_RHOPB Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB18) GN=metN PE=3 SV=1 353 569 4.0E-14
sp|Q92QN0|LOLD_RHIME Lipoprotein-releasing system ATP-binding protein LolD OS=Rhizobium meliloti (strain 1021) GN=lolD PE=3 SV=1 350 549 4.0E-14
sp|Q6D0F3|THIQ_PECAS Thiamine import ATP-binding protein ThiQ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thiQ PE=3 SV=2 350 558 4.0E-14
sp|Q82G23|PSTB_STRAW Phosphate import ATP-binding protein PstB OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pstB PE=3 SV=1 343 557 4.0E-14
sp|Q748K0|Y3001_GEOSL Putative ABC transporter ATP-binding protein GSU3001 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU3001 PE=3 SV=1 343 553 4.0E-14
sp|Q46ZU5|SSUB_CUPPJ Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ssuB PE=3 SV=1 302 546 4.0E-14
sp|Q6AMR9|LOLD_DESPS Lipoprotein-releasing system ATP-binding protein LolD OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lolD PE=3 SV=1 355 546 4.0E-14
sp|Q7VV72|METN_BORPE Methionine import ATP-binding protein MetN OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metN PE=3 SV=1 328 552 4.0E-14
sp|Q7W4E1|METN_BORPA Methionine import ATP-binding protein MetN OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metN PE=3 SV=1 328 552 4.0E-14
sp|Q7WFU9|METN_BORBR Methionine import ATP-binding protein MetN OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metN PE=3 SV=1 328 552 4.0E-14
sp|Q8EEV5|LOLD_SHEON Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella oneidensis (strain MR-1) GN=lolD PE=3 SV=1 341 546 4.0E-14
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 328 559 4.0E-14
sp|Q2JPW6|PHNC1_SYNJB Phosphonates import ATP-binding protein PhnC 1 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC1 PE=3 SV=1 353 559 4.0E-14
sp|Q2GE91|LOLD_NEOSM Lipoprotein-releasing system ATP-binding protein LolD OS=Neorickettsia sennetsu (strain Miyayama) GN=lolD PE=3 SV=1 326 529 4.0E-14
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 350 547 4.0E-14
sp|Q49WM4|POTA_STAS1 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=potA PE=3 SV=1 328 581 4.0E-14
sp|A0LM36|MACB_SYNFM Macrolide export ATP-binding/permease protein MacB OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=macB PE=3 SV=1 334 529 4.0E-14
sp|Q0SVB6|PSTB_CLOPS Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain SM101 / Type A) GN=pstB PE=3 SV=1 330 553 4.0E-14
sp|Q8XMP8|PSTB_CLOPE Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain 13 / Type A) GN=pstB PE=3 SV=1 330 553 4.0E-14
sp|Q0TTG6|PSTB_CLOP1 Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pstB PE=3 SV=1 330 553 4.0E-14
sp|Q3ATR5|MACB_CHLCH Macrolide export ATP-binding/permease protein MacB OS=Chlorobium chlorochromatii (strain CaD3) GN=macB PE=3 SV=1 334 549 4.0E-14
sp|Q8U242|PSTB_PYRFU Phosphate import ATP-binding protein PstB OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pstB PE=3 SV=1 355 553 4.0E-14
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 326 546 4.0E-14
sp|Q8RGC8|FBPC_FUSNN Fe(3+) ions import ATP-binding protein FbpC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fbpC PE=3 SV=1 350 578 5.0E-14
sp|Q2IYS5|PHNC1_RHOP2 Phosphonates import ATP-binding protein PhnC 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=phnC1 PE=3 SV=2 353 555 5.0E-14
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 353 557 5.0E-14
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 326 561 5.0E-14
sp|Q9EUS2|PSTB_STRGR Phosphate import ATP-binding protein PstB OS=Streptomyces griseus GN=pstB PE=3 SV=1 343 557 5.0E-14
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 327 560 5.0E-14
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 339 527 5.0E-14
sp|Q8ZX91|PSTB_PYRAE Phosphate import ATP-binding protein PstB OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pstB PE=3 SV=1 332 557 5.0E-14
sp|Q5H0G3|LOLD_XANOR Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lolD PE=3 SV=1 353 553 5.0E-14
sp|Q2P3E1|LOLD_XANOM Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lolD PE=3 SV=1 353 553 5.0E-14
sp|Q5F8K2|LOLD_NEIG1 Lipoprotein-releasing system ATP-binding protein LolD OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lolD PE=3 SV=1 350 546 5.0E-14
sp|Q7NTU0|LOLD_CHRVO Lipoprotein-releasing system ATP-binding protein LolD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lolD PE=3 SV=1 340 555 5.0E-14
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 326 546 5.0E-14
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 328 552 6.0E-14
sp|P55662|Y4TH_RHISN Probable amino-acid ABC transporter ATP-binding protein y4tH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01510 PE=3 SV=1 328 539 6.0E-14
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 350 554 6.0E-14
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 326 559 6.0E-14
sp|Q1QX72|LOLD_CHRSD Lipoprotein-releasing system ATP-binding protein LolD OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lolD PE=3 SV=2 340 547 6.0E-14
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 327 560 7.0E-14
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 350 594 7.0E-14
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 327 560 7.0E-14
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 327 560 7.0E-14
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 327 560 7.0E-14
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 327 560 7.0E-14
sp|Q5M397|POTA_STRT2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=potA PE=3 SV=1 330 581 7.0E-14
sp|Q5LYN4|POTA_STRT1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain CNRZ 1066) GN=potA PE=3 SV=1 330 581 7.0E-14
sp|Q1RK34|LOLD_RICBR Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia bellii (strain RML369-C) GN=lolD PE=3 SV=1 328 546 7.0E-14
sp|Q03JH1|POTA_STRTD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=potA PE=3 SV=1 330 581 8.0E-14
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 327 560 8.0E-14
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 330 552 8.0E-14
sp|Q9AT00|TGD3_ARATH Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic OS=Arabidopsis thaliana GN=TGD3 PE=1 SV=1 332 552 8.0E-14
sp|Q9HNI8|PHNC_HALSA Phosphonates import ATP-binding protein PhnC OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=phnC PE=3 SV=1 332 552 8.0E-14
sp|Q31J97|HMUV_THICR Hemin import ATP-binding protein HmuV OS=Thiomicrospira crunogena (strain XCL-2) GN=hmuV PE=3 SV=1 342 552 8.0E-14
sp|Q9CEW8|PSTB1_LACLA Phosphate import ATP-binding protein PstB 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pstB1 PE=3 SV=1 323 561 8.0E-14
sp|Q4W575|FBPC_NEIMB Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbpC PE=3 SV=1 327 573 8.0E-14
sp|Q9JVH1|FBPC_NEIMA Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbpC PE=3 SV=1 327 573 8.0E-14
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 320 552 8.0E-14
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 320 552 8.0E-14
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 320 552 8.0E-14
sp|Q21Y06|PHNC2_RHOFT Phosphonates import ATP-binding protein PhnC 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=phnC2 PE=3 SV=1 350 557 8.0E-14
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 395 581 9.0E-14
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 323 573 9.0E-14
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 339 553 9.0E-14
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 352 556 9.0E-14
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 353 557 2.0E-10
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 346 511 2.0E-08
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 340 582 3.0E-07
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 353 565 6.0E-07
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 444 552 1.0E-06
sp|Q81HW8|RBSA_BACCR Ribose import ATP-binding protein RbsA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbsA PE=3 SV=1 330 548 2.0E-06
sp|Q6HNE7|RBSA_BACHK Ribose import ATP-binding protein RbsA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rbsA PE=3 SV=1 330 548 9.0E-06
sp|Q81V36|RBSA_BACAN Ribose import ATP-binding protein RbsA OS=Bacillus anthracis GN=rbsA PE=3 SV=2 330 548 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0022804 active transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0043167 ion binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0030554 adenyl nucleotide binding No
GO:0022857 transmembrane transporter activity No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 274 296 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8487
MGGRPDHCPPCFNCLLPAHTCSQYASCNEYNGKCECPAGFGGDDCLEPLCGSLARGKDRPMRSGAACECDGGWAG
INCNVCTNNEACDALMETGNGGVCYQNGEVVNNNHQMCRVTNKQITTLLGKQVPEVTFGCQKKASECNFQFWVDA
VESFFCHLTECQSGANFDEAKNTTSYKCGQIRCSCIPGRMLCGKDGSVDLSDFLKQSIRGPGSFECIYNKRGSHD
CAFSEPEMDKLIHQLIGDSSILLDCQPGECLYETEVPGYQRPVKQINTPLIASVIAACALFVVALIILTWFRSRR
KLKYGAIRLEDSDDEATKLMNDHKPVALYFENVSYSLNQINILSQIQGICRPGEVTAIMGASGAGKTTFLDILAR
KNKRGQVSGNFFVNGEGVSDSEFKNVVGFVDQEDAMLPTLTVHETILNSALLRLPRDMSRLAKEQRAFEVEKELG
IYHIRDSLVGSEDGSGRGISGGEKRRVGIACELVTSPSILFLDEPTSGLDSFNAYNVVECLVTLAKNYKRTIIFT
IHQPRSNIVALFDRLILLAQGKTVYSGPFSQCQSYFDTTGYQCPPGFNIADYLVDLTMHAGTSIPVDDGTNTADA
ASVGPSSTKAVKSVASMSGASTGEDSNPDWYSGLPRSRFGDSETRGQYRRLIGRRRRGNRSEIADSIREEIRQAP
IC
Coding >Ophio5|8487
ATGGGCGGCCGTCCTGATCACTGCCCTCCTTGTTTCAACTGCCTACTTCCAGCTCACACCTGCTCTCAATACGCC
AGCTGCAACGAGTATAATGGGAAATGCGAGTGCCCTGCTGGGTTTGGAGGGGACGATTGTCTCGAACCTTTATGC
GGCTCACTCGCCCGCGGCAAGGACAGGCCCATGCGATCCGGCGCGGCTTGTGAATGTGATGGCGGTTGGGCTGGC
ATCAATTGCAACGTCTGCACGAATAATGAAGCGTGCGATGCCTTGATGGAGACCGGCAACGGGGGTGTTTGCTAT
CAGAATGGCGAGGTTGTCAACAATAACCACCAGATGTGCAGGGTTACGAACAAGCAGATCACGACTCTTCTTGGG
AAGCAAGTTCCTGAAGTGACATTCGGCTGCCAAAAGAAGGCGTCTGAATGTAACTTTCAATTTTGGGTTGATGCC
GTTGAGTCCTTCTTCTGTCATCTCACCGAATGCCAATCCGGCGCAAACTTTGACGAGGCGAAGAACACGACGTCT
TACAAATGTGGGCAGATCAGGTGCAGCTGCATCCCAGGGCGCATGCTGTGCGGCAAAGATGGCTCCGTTGATCTC
AGCGACTTTCTCAAGCAATCGATTCGGGGTCCGGGCAGCTTTGAATGCATCTATAACAAGCGCGGATCCCACGAT
TGTGCTTTTTCGGAACCCGAAATGGACAAACTCATTCATCAGCTCATTGGCGATTCCAGCATCCTTTTGGATTGT
CAACCGGGCGAATGCTTGTATGAGACCGAGGTGCCTGGCTATCAGCGTCCGGTCAAACAAATCAACACTCCCCTC
ATTGCTAGTGTCATCGCGGCATGCGCTCTTTTCGTCGTTGCCCTCATCATACTGACCTGGTTTCGTTCGCGCCGC
AAACTCAAATACGGGGCAATCCGCTTGGAAGATTCTGACGACGAGGCAACCAAGCTGATGAACGACCACAAACCA
GTAGCCCTTTATTTCGAGAACGTCTCGTATTCTCTGAATCAAATCAACATACTCAGCCAAATTCAGGGCATATGT
CGTCCCGGGGAGGTGACGGCCATCATGGGTGCGTCTGGTGCTGGGAAGACGACTTTTCTCGACATCCTGGCTCGG
AAGAACAAGCGCGGCCAAGTCTCTGGCAATTTTTTCGTTAACGGTGAAGGAGTCAGCGATTCGGAGTTCAAAAAT
GTCGTGGGGTTTGTGGATCAAGAAGATGCCATGCTCCCCACGCTCACTGTGCACGAGACGATCCTCAACAGCGCA
CTTCTGCGACTGCCGCGAGACATGAGTCGCCTTGCCAAAGAGCAGAGGGCATTTGAGGTGGAGAAAGAGTTGGGA
ATCTACCACATTCGGGACTCGCTCGTTGGCTCCGAAGACGGCAGTGGCCGCGGGATATCTGGTGGCGAGAAACGA
CGAGTGGGAATCGCCTGCGAGCTTGTAACAAGCCCCTCGATTCTCTTTCTCGACGAACCCACAAGCGGACTGGAT
TCTTTCAACGCTTACAACGTGGTTGAATGCCTCGTCACTCTAGCGAAAAACTATAAAAGGACCATTATCTTCACC
ATTCACCAACCTCGGTCCAATATCGTGGCGCTTTTCGATCGACTAATACTTTTAGCTCAGGGCAAAACGGTCTAT
TCAGGTCCATTTTCTCAATGCCAATCGTACTTCGACACAACGGGCTACCAATGCCCGCCTGGGTTCAACATAGCC
GACTACCTCGTCGATCTCACAATGCATGCGGGAACTAGCATACCTGTCGACGACGGAACCAACACCGCCGACGCG
GCGAGCGTTGGCCCAAGCAGCACCAAAGCGGTCAAGTCGGTGGCCAGCATGTCGGGGGCCAGCACAGGAGAGGAC
AGCAATCCCGACTGGTATTCCGGCCTGCCCAGAAGCCGGTTTGGCGACTCTGAAACGCGTGGCCAATACCGCCGC
CTCATCGGACGCCGGCGGCGAGGAAACCGGTCCGAAATTGCCGACAGCATCCGTGAGGAGATAAGGCAGGCTCCC
ATCTGT
Transcript >Ophio5|8487
ATGGGCGGCCGTCCTGATCACTGCCCTCCTTGTTTCAACTGCCTACTTCCAGCTCACACCTGCTCTCAATACGCC
AGCTGCAACGAGTATAATGGGAAATGCGAGTGCCCTGCTGGGTTTGGAGGGGACGATTGTCTCGAACCTTTATGC
GGCTCACTCGCCCGCGGCAAGGACAGGCCCATGCGATCCGGCGCGGCTTGTGAATGTGATGGCGGTTGGGCTGGC
ATCAATTGCAACGTCTGCACGAATAATGAAGCGTGCGATGCCTTGATGGAGACCGGCAACGGGGGTGTTTGCTAT
CAGAATGGCGAGGTTGTCAACAATAACCACCAGATGTGCAGGGTTACGAACAAGCAGATCACGACTCTTCTTGGG
AAGCAAGTTCCTGAAGTGACATTCGGCTGCCAAAAGAAGGCGTCTGAATGTAACTTTCAATTTTGGGTTGATGCC
GTTGAGTCCTTCTTCTGTCATCTCACCGAATGCCAATCCGGCGCAAACTTTGACGAGGCGAAGAACACGACGTCT
TACAAATGTGGGCAGATCAGGTGCAGCTGCATCCCAGGGCGCATGCTGTGCGGCAAAGATGGCTCCGTTGATCTC
AGCGACTTTCTCAAGCAATCGATTCGGGGTCCGGGCAGCTTTGAATGCATCTATAACAAGCGCGGATCCCACGAT
TGTGCTTTTTCGGAACCCGAAATGGACAAACTCATTCATCAGCTCATTGGCGATTCCAGCATCCTTTTGGATTGT
CAACCGGGCGAATGCTTGTATGAGACCGAGGTGCCTGGCTATCAGCGTCCGGTCAAACAAATCAACACTCCCCTC
ATTGCTAGTGTCATCGCGGCATGCGCTCTTTTCGTCGTTGCCCTCATCATACTGACCTGGTTTCGTTCGCGCCGC
AAACTCAAATACGGGGCAATCCGCTTGGAAGATTCTGACGACGAGGCAACCAAGCTGATGAACGACCACAAACCA
GTAGCCCTTTATTTCGAGAACGTCTCGTATTCTCTGAATCAAATCAACATACTCAGCCAAATTCAGGGCATATGT
CGTCCCGGGGAGGTGACGGCCATCATGGGTGCGTCTGGTGCTGGGAAGACGACTTTTCTCGACATCCTGGCTCGG
AAGAACAAGCGCGGCCAAGTCTCTGGCAATTTTTTCGTTAACGGTGAAGGAGTCAGCGATTCGGAGTTCAAAAAT
GTCGTGGGGTTTGTGGATCAAGAAGATGCCATGCTCCCCACGCTCACTGTGCACGAGACGATCCTCAACAGCGCA
CTTCTGCGACTGCCGCGAGACATGAGTCGCCTTGCCAAAGAGCAGAGGGCATTTGAGGTGGAGAAAGAGTTGGGA
ATCTACCACATTCGGGACTCGCTCGTTGGCTCCGAAGACGGCAGTGGCCGCGGGATATCTGGTGGCGAGAAACGA
CGAGTGGGAATCGCCTGCGAGCTTGTAACAAGCCCCTCGATTCTCTTTCTCGACGAACCCACAAGCGGACTGGAT
TCTTTCAACGCTTACAACGTGGTTGAATGCCTCGTCACTCTAGCGAAAAACTATAAAAGGACCATTATCTTCACC
ATTCACCAACCTCGGTCCAATATCGTGGCGCTTTTCGATCGACTAATACTTTTAGCTCAGGGCAAAACGGTCTAT
TCAGGTCCATTTTCTCAATGCCAATCGTACTTCGACACAACGGGCTACCAATGCCCGCCTGGGTTCAACATAGCC
GACTACCTCGTCGATCTCACAATGCATGCGGGAACTAGCATACCTGTCGACGACGGAACCAACACCGCCGACGCG
GCGAGCGTTGGCCCAAGCAGCACCAAAGCGGTCAAGTCGGTGGCCAGCATGTCGGGGGCCAGCACAGGAGAGGAC
AGCAATCCCGACTGGTATTCCGGCCTGCCCAGAAGCCGGTTTGGCGACTCTGAAACGCGTGGCCAATACCGCCGC
CTCATCGGACGCCGGCGGCGAGGAAACCGGTCCGAAATTGCCGACAGCATCCGTGAGGAGATAAGGCAGGCTCCC
ATCTGTTGA
Gene >Ophio5|8487
ATGGGCGGCCGTCCTGATCACTGCCCTCCTTGGTAGGAATACGGAATCTTCGGTTAATAGCGTTTGATGAGATCG
CTTTCCTGACGGGACGAGACTCAGTTTCAACTGCCTACTTCCAGCTCACACCTGCTCTCAATACGCCAGCTGCAA
CGAGTATAATGGGAAATGCGAGTGCCCTGCTGGGTTTGGAGGGGACGATTGTCTCGAACCTTGTATGTTTTCACG
CCGATATCAGCATCAAACCCATTCCCATAGCCACGAGCCCGCGGATCATGATTACTGATTCGCGCCCAGTATGCG
GCTCACTCGCCCGCGGCAAGGACAGGCCCATGCGATCCGGCGCGGCTTGTGAATGTGATGGCGGTTGGGCTGGCA
TCAATTGCAACGTCTGCACGAATAATGAAGCGTGCGATGCCTTGATGGAGACCGGCAACGGGGGTGTTTGCTATC
AGAATGGCGAGGTTGTCAACAATAACCACCAGATGTGCAGGGTTACGAACAAGCAGATCACGACTCTTCTTGGGA
AGCAAGTTCCTGAAGTGACATTCGGCTGCCAAAAGAAGGCGTCTGAATGTAACTTTCAATGTAAGTTTTGCATAA
GCCATTGAGATCGCAATGAGGTCAATACTCACGCGGGTGTTATCTTCCAGTTTGGGTTGATGCCGTTGAGTCCTT
CTTCTGTCATCTCACCGAATGCCAATCCGGCGCAAACTTTGACGAGGCGAAGAACACGACGTCTTACAAATGTGG
GCAGATCAGGTGCAGCTGCATCCCAGGGCGCATGCTGTGCGGCAAAGATGGCTCCGTTGATCTCAGCGACTTTCT
CAAGCAATCGATTCGGGGTCCGGGCAGCTTTGAATGCATCTATAACAAGCGCGGATCCCACGATTGTGCTTTTTC
GGAACCCGAAATGGACAAACTCATTCATCAGCTCATTGGCGATTCCAGCATCCTTTTGGATTGTCAACCGGGCGA
ATGCTTGTATGAGACCGAGGTGCCTGGCTATCAGCGTCCGGTCAAACAAATCAACACTCCCCTCATTGCTAGTGT
CATCGCGGCATGCGCTCTTTTCGTCGTTGCCCTCATCATACTGACCTGGTTTCGTTCGCGCCGCAAACTCAAATA
CGGGGCAATCCGCTTGGAAGATTCTGACGACGAGGCAACCAAGCTGATGAACGACCACAAACCAGTAGCCCTTTA
TTTCGAGAACGTCTCGTATTCTCTGAATCAAATCAACATACTCAGCCAAATTCAGGGCATATGTCGTCCCGGGGA
GGTGACGGCCATCATGGGTGCGTCTGGTGCTGGGAAGACGACTTTTCTCGACATCCTGGCTCGGAAGAACAAGCG
CGGCCAAGTCTCTGGCAATTTTTTCGTTAACGGTGAAGGAGTCAGCGATTCGGAGTTCAAAAATGTCGTGGGGTT
TGTGGATCAAGAAGATGCCATGCTCCCCACGCTCACTGTGCACGAGACGATCCTCAACAGCGCACTTCTGCGACT
GCCGCGAGACATGAGTCGCCTTGCCAAAGAGCAGAGGGCATTTGAGGTGGAGAAAGAGTTGGGAATCTACCACAT
TCGGGACTCGCTCGTTGGCTCCGAAGACGGCAGTGGCCGCGGGATATCTGGTGGCGAGAAACGACGAGTGGGAAT
CGCCTGCGAGCTTGTAACAAGCCCCTCGATTCTCTTTCTCGACGAACCCACAAGCGGACTGGATTCTTTCAACGC
TTACAACGTGGTTGAATGCCTCGTCACTCTAGCGAAAAACTATAAAAGGACCATTATCTTCACCATTCACCAACC
TCGGTCCAATATCGTGGCGCTTTTCGATCGACTAATACTTTTAGCTCAGGGCAAAACGGTCTATTCAGGTCCATT
TTCTCAATGCCAATCGTACTTCGACACAACGGGCTACCAATGCCCGCCTGGGTTCAACATAGCCGACTACCTCGT
CGATCTCACAATGCATGCGGGAACTAGCATACCTGTCGACGACGGAACCAACACCGCCGACGCGGCGAGCGTTGG
CCCAAGCAGCACCAAAGCGGTCAAGTCGGTGGCCAGCATGTCGGGGGCCAGCACAGGAGAGGACAGCAATCCCGA
CTGGTATTCCGGCCTGCCCAGAAGCCGGTTTGGCGACTCTGTCAGGACTCGTCAGGAGCGAGAGCTATTCACACG
CAGGAAACGCGTGGCCAATACCGCCGCCTCATCGGACGCCGGCGGCGAGGAAACCGGTGCGTATCGTCTTCGGGT
CAACCCAGCCGCTTACGGTACGATATCACAGCCAGCGGACGACAGATACGCACTGCCACTGGCTGCAGATACAGG
TACTGACCTGGACCTCATGACACAATCTTTCGCTAGGTCCGAAATTGCCGACAGCATCCGTGAGGAGATAAGGCA
GGCTGTGAGCACGGCCAATGAAGCTAATCGGCAAAATGACATTGACGCAGCCAGCCCATCTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail