Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|848
Gene name
Locationscaffold_125:2951..4177
Strand+
Gene length (bp)1226
Transcript length (bp)1137
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 6.0E-65 13 287
PF01370 Epimerase NAD dependent epimerase/dehydratase family 6.2E-32 12 238
PF04321 RmlD_sub_bind RmlD substrate binding domain 9.1E-16 11 285
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 9.0E-14 13 233
PF07993 NAD_binding_4 Male sterility protein 2.1E-08 76 192
PF13460 NAD_binding_10 NAD(P)H-binding 1.2E-09 16 191
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 2.6E-04 56 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG26 PE=1 SV=1 12 363 9.0E-80
sp|O43050|ERG26_SCHPO Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg26 PE=3 SV=1 8 360 2.0E-78
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus GN=Nsdhl PE=1 SV=1 14 366 6.0E-52
sp|Q3ZBE9|NSDHL_BOVIN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Bos taurus GN=NSDHL PE=2 SV=1 14 361 8.0E-50
sp|Q9FX01|HSDD1_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 OS=Arabidopsis thaliana GN=3BETAHSD/D1 PE=2 SV=1 13 361 3.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG26 PE=1 SV=1 12 363 9.0E-80
sp|O43050|ERG26_SCHPO Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg26 PE=3 SV=1 8 360 2.0E-78
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus GN=Nsdhl PE=1 SV=1 14 366 6.0E-52
sp|Q3ZBE9|NSDHL_BOVIN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Bos taurus GN=NSDHL PE=2 SV=1 14 361 8.0E-50
sp|Q9FX01|HSDD1_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 OS=Arabidopsis thaliana GN=3BETAHSD/D1 PE=2 SV=1 13 361 3.0E-49
sp|Q5PPL3|NSDHL_RAT Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Rattus norvegicus GN=Nsdhl PE=2 SV=1 14 366 4.0E-49
sp|Q15738|NSDHL_HUMAN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens GN=NSDHL PE=1 SV=2 14 361 7.0E-49
sp|Q67ZE1|HSDD2_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 OS=Arabidopsis thaliana GN=3BETAHSD/D2 PE=2 SV=2 13 361 2.0E-43
sp|A9X4U2|HSDD3_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 3 OS=Arabidopsis thaliana GN=3BETAHSD/D3 PE=2 SV=2 9 361 5.0E-36
sp|A8DZE7|D42E1_DANRE Short-chain dehydrogenase/reductase family 42E member 1 OS=Danio rerio GN=sdr42e1 PE=2 SV=1 4 361 1.0E-33
sp|P9WQP7|3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1106c PE=1 SV=1 9 362 1.0E-29
sp|P9WQP6|3BHS_MYCTO 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1137 PE=3 SV=1 9 362 1.0E-29
sp|P14060|3BHS1_HUMAN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Homo sapiens GN=HSD3B1 PE=1 SV=2 13 375 6.0E-29
sp|Q32L94|D42E1_BOVIN Short-chain dehydrogenase/reductase family 42E member 1 OS=Bos taurus GN=SDR42E1 PE=2 SV=2 78 361 1.0E-28
sp|P27365|3BHS1_MACMU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Macaca mulatta GN=HSD3B1 PE=2 SV=2 13 375 2.0E-28
sp|P26439|3BHS2_HUMAN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Homo sapiens GN=HSD3B2 PE=1 SV=2 13 375 2.0E-28
sp|Q8WUS8|D42E1_HUMAN Short-chain dehydrogenase/reductase family 42E member 1 OS=Homo sapiens GN=SDR42E1 PE=2 SV=2 12 361 6.0E-28
sp|Q4R7R1|D42E1_MACFA Short-chain dehydrogenase/reductase family 42E member 1 OS=Macaca fascicularis GN=SDR42E1 PE=2 SV=1 12 361 1.0E-27
sp|Q9D665|D42E1_MOUSE Short-chain dehydrogenase/reductase family 42E member 1 OS=Mus musculus GN=Sdr42e1 PE=1 SV=1 12 361 1.0E-25
sp|Q0IH73|D42E1_XENLA Short-chain dehydrogenase/reductase family 42E member 1 OS=Xenopus laevis GN=sdr42e1 PE=2 SV=1 12 346 3.0E-25
sp|P26149|3BHS2_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Mus musculus GN=Hsd3b2 PE=1 SV=4 13 366 1.0E-24
sp|Q60555|3BHS1_MESAU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Mesocricetus auratus GN=HSD3B1 PE=2 SV=3 13 347 8.0E-24
sp|Q5IFP1|3BHS_CANLF 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Canis lupus familiaris GN=HSD3B PE=2 SV=3 13 360 9.0E-24
sp|P24815|3BHS1_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Mus musculus GN=Hsd3b1 PE=1 SV=3 13 366 1.0E-23
sp|Q62878|3BHS4_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4 OS=Rattus norvegicus GN=Hsd3b6 PE=2 SV=4 13 366 2.0E-23
sp|Q64421|3BHS2_MESAU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Mesocricetus auratus GN=HSD3B2 PE=2 SV=3 13 347 3.0E-23
sp|P26150|3BHS3_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3 OS=Mus musculus GN=Hsd3b3 PE=1 SV=3 13 366 5.0E-23
sp|P14893|3BHS_BOVIN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Bos taurus GN=HSD3B PE=1 SV=2 13 361 1.0E-22
sp|P26670|3BHS_VACCW 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Vaccinia virus (strain Western Reserve) GN=VACWR170 PE=3 SV=1 14 365 1.0E-22
sp|O57245|3BHS_VACCA 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Vaccinia virus (strain Ankara) GN=MVA157L PE=3 SV=1 14 365 1.0E-22
sp|P21097|3BHS_VACCC 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Vaccinia virus (strain Copenhagen) GN=A44L PE=3 SV=1 14 365 3.0E-22
sp|P22071|3BHS1_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Rattus norvegicus GN=Hsd3b1 PE=2 SV=3 13 366 4.0E-22
sp|O35469|3BHS6_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6 OS=Mus musculus GN=Hsd3b6 PE=1 SV=4 13 366 7.0E-22
sp|Q61767|3BHS4_MOUSE 3 beta-hydroxysteroid dehydrogenase type 4 OS=Mus musculus GN=Hsd3b4 PE=1 SV=3 13 361 2.0E-21
sp|P22072|3BHS2_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Rattus norvegicus GN=Hsd3b PE=2 SV=3 13 366 3.0E-21
sp|P27364|3BHS5_RAT 3 beta-hydroxysteroid dehydrogenase type 5 OS=Rattus norvegicus GN=Hsd3b5 PE=2 SV=3 13 366 5.0E-21
sp|Q9EQC1|3BHS7_MOUSE 3 beta-hydroxysteroid dehydrogenase type 7 OS=Mus musculus GN=Hsd3b7 PE=1 SV=1 1 360 1.0E-20
sp|Q61694|3BHS5_MOUSE 3 beta-hydroxysteroid dehydrogenase type 5 OS=Mus musculus GN=Hsd3b5 PE=1 SV=4 13 361 2.0E-20
sp|Q9N119|3BHS_PIG 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Sus scrofa GN=HSD3B PE=2 SV=4 13 360 5.0E-20
sp|Q9H2F3|3BHS7_HUMAN 3 beta-hydroxysteroid dehydrogenase type 7 OS=Homo sapiens GN=HSD3B7 PE=1 SV=2 13 360 5.0E-20
sp|O46516|3BHS_HORSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Equus caballus GN=HSD3B PE=2 SV=3 13 377 1.0E-19
sp|O35296|3BHS3_MESAU 3 beta-hydroxysteroid dehydrogenase type 3 OS=Mesocricetus auratus GN=HSD3B3 PE=2 SV=3 8 360 2.0E-19
sp|Q67477|3BHS_FOWPN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Fowlpox virus (strain NVSL) GN=FPV046 PE=3 SV=2 13 374 3.0E-19
sp|A6NKP2|D42E2_HUMAN Putative short-chain dehydrogenase/reductase family 42E member 2 OS=Homo sapiens GN=SDR42E2 PE=3 SV=3 12 346 9.0E-19
sp|O35048|3BHS7_RAT 3 beta-hydroxysteroid dehydrogenase type 7 OS=Rattus norvegicus GN=Hsd3b7 PE=2 SV=1 1 360 5.0E-15
sp|Q6GZS4|052L_FRG3G Uncharacterized protein 052L OS=Frog virus 3 (isolate Goorha) GN=FV3-052L PE=3 SV=1 13 360 5.0E-15
sp|Q8X7P7|GNU_ECO57 N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase OS=Escherichia coli O157:H7 GN=gnu PE=1 SV=1 11 229 2.0E-11
sp|Q56093|GALE_SALTI UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2 12 240 5.0E-11
sp|P45602|GALE_KLEPN UDP-glucose 4-epimerase (Fragment) OS=Klebsiella pneumoniae GN=galE PE=3 SV=1 12 133 5.0E-11
sp|P22715|GALE_SALTY UDP-glucose 4-epimerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galE PE=3 SV=2 12 240 6.0E-11
sp|P09147|GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) GN=galE PE=1 SV=1 12 240 5.0E-10
sp|P96995|GALE_STRMU UDP-glucose 4-epimerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=galE PE=3 SV=2 12 240 7.0E-09
sp|P75821|YBJS_ECOLI Uncharacterized protein YbjS OS=Escherichia coli (strain K12) GN=ybjS PE=3 SV=2 93 369 1.0E-08
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 12 240 5.0E-08
sp|Q9Y7X5|UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uge1 PE=1 SV=1 10 240 1.0E-07
sp|O84903|GALE_LACCA UDP-glucose 4-epimerase OS=Lactobacillus casei GN=galE PE=3 SV=1 12 240 2.0E-07
sp|P21977|GALE_STRTR UDP-glucose 4-epimerase OS=Streptococcus thermophilus GN=galE PE=3 SV=1 12 240 2.0E-07
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 11 240 3.0E-07
sp|P39858|CAPI_STAAU Protein CapI OS=Staphylococcus aureus GN=capI PE=3 SV=1 12 318 3.0E-07
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 12 240 3.0E-07
sp|Q9F7D4|GALE_YERPE UDP-glucose 4-epimerase OS=Yersinia pestis GN=galE PE=3 SV=1 11 240 6.0E-07
sp|P75517|GALE_MYCPN UDP-glucose 4-epimerase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=galE PE=3 SV=1 12 236 3.0E-06
sp|P55579|Y4NG_RHISN Uncharacterized protein y4nG OS=Rhizobium sp. (strain NGR234) GN=NGR_a02350 PE=3 SV=1 13 361 3.0E-06
sp|Q40316|VESTR_MEDSA Vestitone reductase OS=Medicago sativa PE=1 SV=1 10 174 6.0E-06
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 12 167 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0044238 primary metabolic process No
GO:0016491 oxidoreductase activity No
GO:0016229 steroid dehydrogenase activity No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 66.08 35.59 96.57
CcL In ants, during behavior modification 63.16 33.33 92.99
CcD In ants, recently dead 46.27 23.80 68.73

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.881149 no
SC16a CcD 0.138969 no
CcL CcD 0.213531 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|848
MASEESRPLGHVLVIGGNGFLGHHIMTQALSRWTTTAVSSVDLRSDRNRHPDACYHECDITDGPRLAQLLGRLRP
DVVIHTASPVASGEQGAATRELYHSVNVQGTSAVVEACRAAAVKALVYTSSASVVSDNVSDLFNVDETWPRVRGS
RQREYYSETKAAAEEIVLAANRQSPSSTLLTTALRPAGIFGEGDVQLLAGLLRVHRNGKTNIQLGDNGNIFDFTY
VGNVAHAHLVAAHALLLSAASAVAPLDHERVDGEAFFITNDSPCYFWDFARAVWRAAGLDAGVDAVWVLPRSLAI
SLGFLSEVFCRWLGKPPTFTRQRAVISTMTRYYNINKAKTVLRYEPIWSLPEGVARGVAWFLEQDRLAKAIQEKT
VTA
Coding >Ophio5|848
ATGGCATCAGAAGAATCCCGTCCGCTGGGCCACGTCCTCGTCATCGGCGGCAACGGCTTTCTCGGCCACCACATC
ATGACCCAAGCACTGAGCCGATGGACCACAACGGCTGTAAGCTCGGTCGACCTCCGCAGCGACCGTAACCGTCAC
CCCGACGCATGCTATCACGAGTGCGACATCACCGACGGCCCGCGCCTCGCTCAGCTGCTCGGCCGTCTGCGGCCG
GACGTGGTGATTCACACGGCCAGCCCGGTCGCGAGCGGAGAGCAGGGCGCCGCGACGCGAGAGCTCTACCATTCC
GTCAATGTCCAAGGGACGAGCGCGGTCGTGGAAGCATGTCGTGCTGCGGCTGTCAAAGCGCTCGTGTATACTAGC
TCGGCAAGTGTCGTTAGCGATAACGTCTCGGATCTGTTTAATGTCGATGAGACGTGGCCGAGGGTTCGGGGGTCG
CGACAGCGCGAGTATTACTCGGAGACGAAGGCCGCAGCCGAAGAAATCGTCCTCGCTGCCAACAGACAGAGCCCT
TCTTCCACGCTGCTAACGACCGCTCTCCGCCCAGCCGGCATCTTCGGCGAAGGCGACGTCCAACTGCTAGCCGGC
CTCCTCCGGGTCCACCGCAACGGCAAGACAAACATCCAGCTAGGCGACAACGGCAACATCTTCGACTTCACCTAC
GTCGGCAACGTCGCCCACGCCCACCTCGTAGCCGCCCACGCGCTTCTCCTCTCCGCCGCCTCGGCCGTGGCGCCT
CTGGACCACGAAAGAGTCGACGGCGAGGCCTTCTTCATCACAAACGATTCGCCCTGTTACTTTTGGGACTTTGCT
CGTGCCGTCTGGCGCGCCGCCGGTCTCGATGCCGGCGTCGACGCTGTATGGGTTCTGCCTAGGAGCCTAGCCATC
TCTTTGGGCTTCTTGTCCGAGGTCTTTTGTCGTTGGCTAGGCAAGCCGCCTACTTTTACCCGTCAGAGGGCTGTC
ATCTCTACCATGACGCGCTATTATAATATCAACAAGGCCAAGACTGTCCTGCGCTATGAACCCATTTGGTCTCTT
CCTGAGGGCGTCGCTCGGGGCGTTGCCTGGTTCTTGGAGCAGGATAGGTTGGCAAAGGCGATTCAGGAAAAGACG
GTGACGGCT
Transcript >Ophio5|848
ATGGCATCAGAAGAATCCCGTCCGCTGGGCCACGTCCTCGTCATCGGCGGCAACGGCTTTCTCGGCCACCACATC
ATGACCCAAGCACTGAGCCGATGGACCACAACGGCTGTAAGCTCGGTCGACCTCCGCAGCGACCGTAACCGTCAC
CCCGACGCATGCTATCACGAGTGCGACATCACCGACGGCCCGCGCCTCGCTCAGCTGCTCGGCCGTCTGCGGCCG
GACGTGGTGATTCACACGGCCAGCCCGGTCGCGAGCGGAGAGCAGGGCGCCGCGACGCGAGAGCTCTACCATTCC
GTCAATGTCCAAGGGACGAGCGCGGTCGTGGAAGCATGTCGTGCTGCGGCTGTCAAAGCGCTCGTGTATACTAGC
TCGGCAAGTGTCGTTAGCGATAACGTCTCGGATCTGTTTAATGTCGATGAGACGTGGCCGAGGGTTCGGGGGTCG
CGACAGCGCGAGTATTACTCGGAGACGAAGGCCGCAGCCGAAGAAATCGTCCTCGCTGCCAACAGACAGAGCCCT
TCTTCCACGCTGCTAACGACCGCTCTCCGCCCAGCCGGCATCTTCGGCGAAGGCGACGTCCAACTGCTAGCCGGC
CTCCTCCGGGTCCACCGCAACGGCAAGACAAACATCCAGCTAGGCGACAACGGCAACATCTTCGACTTCACCTAC
GTCGGCAACGTCGCCCACGCCCACCTCGTAGCCGCCCACGCGCTTCTCCTCTCCGCCGCCTCGGCCGTGGCGCCT
CTGGACCACGAAAGAGTCGACGGCGAGGCCTTCTTCATCACAAACGATTCGCCCTGTTACTTTTGGGACTTTGCT
CGTGCCGTCTGGCGCGCCGCCGGTCTCGATGCCGGCGTCGACGCTGTATGGGTTCTGCCTAGGAGCCTAGCCATC
TCTTTGGGCTTCTTGTCCGAGGTCTTTTGTCGTTGGCTAGGCAAGCCGCCTACTTTTACCCGTCAGAGGGCTGTC
ATCTCTACCATGACGCGCTATTATAATATCAACAAGGCCAAGACTGTCCTGCGCTATGAACCCATTTGGTCTCTT
CCTGAGGGCGTCGCTCGGGGCGTTGCCTGGTTCTTGGAGCAGGATAGGTTGGCAAAGGCGATTCAGGAAAAGACG
GTGACGGCTTGA
Gene >Ophio5|848
ATGGCATCAGAAGAATCCCGTCCGCTGGGCCACGTCCTCGTCATCGGCGGCAACGGCTTTCTCGGCCACCACATC
ATGACCCAAGCACTGAGCCGATGGACCACAACGGCTGTAAGCTCGGTCGACCTCCGCAGCGACCGTAACCGTCAC
CCCGACGCATGCTATCACGAGTGCGACATCACCGACGGCCCGCGCCTCGCTCAGCTGCTCGGCCGTCTGCGGCCG
GACGTGGTGATTCACACGGCCAGCCCGGTCGCGAGCGGAGAGCAGGGCGCCGCGACGCGAGAGCTCTACCATTCC
GTCAATGTCCAAGGGACGAGCGCGGTCGTGGAAGCATGTCGTGCTGCGGCTGTCAAAGCGCTCGTGTATACTAGC
TCGGCAAGTGTCGTTAGCGATAACGTCTCGGATCTGTTTAATGTCGATGAGACGTGGCCGAGGGTTCGGGGGTCG
CGACAGCGCGAGTATTACTCGGAGACGAAGGTGAAAAACTCGGATGCTGCTTCGAAATCCCCCCCCCCCCCCTCC
AATTGTCTACGTGTCAGGCTGATATTGATTATCAAATTTCATAGGCCGCAGCCGAAGAAATCGTCCTCGCTGCCA
ACAGACAGAGCCCTTCTTCCACGCTGCTAACGACCGCTCTCCGCCCAGCCGGCATCTTCGGCGAAGGCGACGTCC
AACTGCTAGCCGGCCTCCTCCGGGTCCACCGCAACGGCAAGACAAACATCCAGCTAGGCGACAACGGCAACATCT
TCGACTTCACCTACGTCGGCAACGTCGCCCACGCCCACCTCGTAGCCGCCCACGCGCTTCTCCTCTCCGCCGCCT
CGGCCGTGGCGCCTCTGGACCACGAAAGAGTCGACGGCGAGGCCTTCTTCATCACAAACGATTCGCCCTGTTACT
TTTGGGACTTTGCTCGTGCCGTCTGGCGCGCCGCCGGTCTCGATGCCGGCGTCGACGCTGTATGGGTTCTGCCTA
GGAGCCTAGCCATCTCTTTGGGCTTCTTGTCCGAGGTCTTTTGTCGTTGGCTAGGCAAGCCGCCTACTTTTACCC
GTCAGAGGGCTGTCATCTCTACCATGACGCGCTATTATAATATCAACAAGGCCAAGACTGTCCTGCGCTATGAAC
CCATTTGGTCTCTTCCTGAGGGCGTCGCTCGGGGCGTTGCCTGGTTCTTGGAGCAGGATAGGTTGGCAAAGGCGA
TTCAGGAAAAGACGGTGACGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail