Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8475
Gene name
Locationscaffold_95:28197..28619
Strand+
Gene length (bp)422
Transcript length (bp)369
Coding sequence length (bp)366
Protein length (aa) 122

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00468 Ribosomal_L34 Ribosomal protein L34 1.7E-14 86 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8ILM7|RL34_AZOC5 50S ribosomal protein L34 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpmH PE=3 SV=1 86 122 7.0E-08
sp|Q38UE3|RL34_LACSS 50S ribosomal protein L34 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpmH PE=3 SV=1 90 122 2.0E-07
sp|A5G0F5|RL34_ACICJ 50S ribosomal protein L34 OS=Acidiphilium cryptum (strain JF-5) GN=rpmH PE=3 SV=1 86 122 2.0E-07
sp|Q5LW05|RL34_RUEPO 50S ribosomal protein L34 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpmH PE=3 SV=2 88 122 3.0E-07
sp|B6IPG6|RL34_RHOCS 50S ribosomal protein L34 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpmH PE=3 SV=1 86 122 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8ILM7|RL34_AZOC5 50S ribosomal protein L34 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpmH PE=3 SV=1 86 122 7.0E-08
sp|Q38UE3|RL34_LACSS 50S ribosomal protein L34 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpmH PE=3 SV=1 90 122 2.0E-07
sp|A5G0F5|RL34_ACICJ 50S ribosomal protein L34 OS=Acidiphilium cryptum (strain JF-5) GN=rpmH PE=3 SV=1 86 122 2.0E-07
sp|Q5LW05|RL34_RUEPO 50S ribosomal protein L34 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpmH PE=3 SV=2 88 122 3.0E-07
sp|B6IPG6|RL34_RHOCS 50S ribosomal protein L34 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpmH PE=3 SV=1 86 122 3.0E-07
sp|Q2KD25|RL34_RHIEC 50S ribosomal protein L34 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpmH PE=3 SV=1 86 122 4.0E-07
sp|B3Q042|RL34_RHIE6 50S ribosomal protein L34 OS=Rhizobium etli (strain CIAT 652) GN=rpmH PE=3 SV=1 86 122 4.0E-07
sp|B3WBV7|RL34_LACCB 50S ribosomal protein L34 OS=Lactobacillus casei (strain BL23) GN=rpmH PE=3 SV=1 94 122 4.0E-07
sp|Q033K5|RL34_LACC3 50S ribosomal protein L34 OS=Lactobacillus casei (strain ATCC 334) GN=rpmH PE=3 SV=1 94 122 4.0E-07
sp|B5ZN44|RL34_RHILW 50S ribosomal protein L34 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpmH PE=3 SV=1 86 122 4.0E-07
sp|A1T0M6|RL34_PSYIN 50S ribosomal protein L34 OS=Psychromonas ingrahamii (strain 37) GN=rpmH PE=3 SV=1 88 122 5.0E-07
sp|Q5QZK0|RL34_IDILO 50S ribosomal protein L34 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpmH PE=3 SV=1 88 122 5.0E-07
sp|B1LUP6|RL34_METRJ 50S ribosomal protein L34 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpmH PE=3 SV=1 86 122 8.0E-07
sp|A5UD74|RL34_HAEIE 50S ribosomal protein L34 OS=Haemophilus influenzae (strain PittEE) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|Q5FPY2|RL34_GLUOX 50S ribosomal protein L34 OS=Gluconobacter oxydans (strain 621H) GN=rpmH PE=3 SV=1 86 122 1.0E-06
sp|A3N3N0|RL34_ACTP2 50S ribosomal protein L34 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|B3H308|RL34_ACTP7 50S ribosomal protein L34 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|B0BTL8|RL34_ACTPJ 50S ribosomal protein L34 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|Q7VN33|RL34_HAEDU 50S ribosomal protein L34 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|B8F7T1|RL34_HAEPS 50S ribosomal protein L34 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|B2FPA7|RL34_STRMK 50S ribosomal protein L34 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|B4SPG2|RL34_STRM5 50S ribosomal protein L34 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|Q2RP15|RL34_RHORT 50S ribosomal protein L34 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|Q92SF3|RL34_RHIME 50S ribosomal protein L34 OS=Rhizobium meliloti (strain 1021) GN=rpmH PE=3 SV=1 86 122 1.0E-06
sp|A6U5L1|RL34_SINMW 50S ribosomal protein L34 OS=Sinorhizobium medicae (strain WSM419) GN=rpmH PE=3 SV=1 86 122 1.0E-06
sp|A6VR64|RL34_ACTSZ 50S ribosomal protein L34 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|Q4QLR3|RL34_HAEI8 50S ribosomal protein L34 OS=Haemophilus influenzae (strain 86-028NP) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|A5UID2|RL34_HAEIG 50S ribosomal protein L34 OS=Haemophilus influenzae (strain PittGG) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|P66244|RL34_HAEIN 50S ribosomal protein L34 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|Q65VB9|RL34_MANSM 50S ribosomal protein L34 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|P66245|RL34_PASMU 50S ribosomal protein L34 OS=Pasteurella multocida (strain Pm70) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|Q0I0Y8|RL34_HAES1 50S ribosomal protein L34 OS=Haemophilus somnus (strain 129Pt) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|B0URU6|RL34_HISS2 50S ribosomal protein L34 OS=Histophilus somni (strain 2336) GN=rpmH PE=3 SV=1 88 122 1.0E-06
sp|P66246|RL34_HELPY 50S ribosomal protein L34 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpmH PE=3 SV=1 90 121 2.0E-06
sp|Q0C551|RL34_HYPNA 50S ribosomal protein L34 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpmH PE=3 SV=1 88 122 2.0E-06
sp|Q5FHQ2|RL34_LACAC 50S ribosomal protein L34 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpmH PE=3 SV=1 94 122 2.0E-06
sp|A8YTR0|RL34_LACH4 50S ribosomal protein L34 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpmH PE=3 SV=1 94 122 2.0E-06
sp|Q1GJX0|RL34_RUEST 50S ribosomal protein L34 OS=Ruegeria sp. (strain TM1040) GN=rpmH PE=3 SV=1 88 122 2.0E-06
sp|Q3IK51|RL34_PSEHT 50S ribosomal protein L34 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpmH PE=3 SV=1 88 122 2.0E-06
sp|Q1CRI2|RL34_HELPH 50S ribosomal protein L34 OS=Helicobacter pylori (strain HPAG1) GN=rpmH PE=3 SV=1 90 121 2.0E-06
sp|P66247|RL34_HELPJ 50S ribosomal protein L34 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpmH PE=3 SV=1 90 121 2.0E-06
sp|B2UVJ2|RL34_HELPS 50S ribosomal protein L34 OS=Helicobacter pylori (strain Shi470) GN=rpmH PE=3 SV=1 90 121 2.0E-06
sp|Q0VKU5|RL34_ALCBS 50S ribosomal protein L34 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpmH PE=3 SV=1 88 122 2.0E-06
sp|A8LMA5|RL34_DINSH 50S ribosomal protein L34 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpmH PE=3 SV=1 88 122 2.0E-06
sp|Q2GH25|RL34_EHRCR 50S ribosomal protein L34 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpmH PE=3 SV=1 86 122 3.0E-06
sp|Q3YRN8|RL34_EHRCJ 50S ribosomal protein L34 OS=Ehrlichia canis (strain Jake) GN=rpmH PE=3 SV=1 86 122 3.0E-06
sp|Q047F6|RL34_LACDB 50S ribosomal protein L34 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpmH PE=3 SV=1 94 122 3.0E-06
sp|Q1G7Z1|RL34_LACDA 50S ribosomal protein L34 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpmH PE=3 SV=1 94 122 3.0E-06
sp|Q0BU81|RL34_GRABC 50S ribosomal protein L34 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpmH PE=3 SV=1 86 122 3.0E-06
sp|A6QAL4|RL34_SULNB 50S ribosomal protein L34 OS=Sulfurovum sp. (strain NBC37-1) GN=rpmH PE=3 SV=1 90 121 3.0E-06
sp|A7IGM5|RL34_XANP2 50S ribosomal protein L34 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpmH PE=3 SV=1 86 122 3.0E-06
sp|A7HPU1|RL34_PARL1 50S ribosomal protein L34 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpmH PE=3 SV=1 86 122 4.0E-06
sp|Q5WAF9|RL34_BACSK 50S ribosomal protein L34 OS=Bacillus clausii (strain KSM-K16) GN=rpmH PE=3 SV=1 91 122 4.0E-06
sp|Q5FFS7|RL34_EHRRG 50S ribosomal protein L34 OS=Ehrlichia ruminantium (strain Gardel) GN=rpmH PE=3 SV=1 86 122 4.0E-06
sp|Q5HAV1|RL34_EHRRW 50S ribosomal protein L34 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpmH PE=3 SV=1 86 122 4.0E-06
sp|A9NE64|RL34_ACHLI 50S ribosomal protein L34 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpmH PE=3 SV=1 86 121 5.0E-06
sp|Q16A96|RL34_ROSDO 50S ribosomal protein L34 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpmH PE=3 SV=1 88 122 6.0E-06
sp|B1Z8E9|RL34_METPB 50S ribosomal protein L34 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpmH PE=3 SV=1 86 122 6.0E-06
sp|A9W592|RL34_METEP 50S ribosomal protein L34 OS=Methylobacterium extorquens (strain PA1) GN=rpmH PE=3 SV=1 86 122 6.0E-06
sp|B7L2I7|RL34_METC4 50S ribosomal protein L34 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpmH PE=3 SV=1 86 122 6.0E-06
sp|Q5PA87|RL34_ANAMM 50S ribosomal protein L34 OS=Anaplasma marginale (strain St. Maries) GN=rpmH PE=3 SV=1 86 122 6.0E-06
sp|B9KJ41|RL34_ANAMF 50S ribosomal protein L34 OS=Anaplasma marginale (strain Florida) GN=rpmH PE=3 SV=1 86 122 6.0E-06
sp|Q1RI67|RL34_RICBR 50S ribosomal protein L34 OS=Rickettsia bellii (strain RML369-C) GN=rpmH PE=3 SV=1 88 122 7.0E-06
sp|A8GVL1|RL34_RICB8 50S ribosomal protein L34 OS=Rickettsia bellii (strain OSU 85-389) GN=rpmH PE=3 SV=1 88 122 7.0E-06
sp|A5VCE4|RL34_SPHWW 50S ribosomal protein L34 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpmH PE=3 SV=1 88 122 9.0E-06
sp|Q9RCA3|RL34_BACHD 50S ribosomal protein L34 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpmH PE=3 SV=1 90 122 9.0E-06
sp|Q2GL30|RL34_ANAPZ 50S ribosomal protein L34 OS=Anaplasma phagocytophilum (strain HZ) GN=rpmH PE=3 SV=1 86 122 9.0E-06
sp|A5G9V7|RL34_GEOUR 50S ribosomal protein L34 OS=Geobacter uraniireducens (strain Rf4) GN=rpmH PE=3 SV=1 90 121 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0006518 peptide metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0043603 cellular amide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019538 protein metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0005198 structural molecule activity No
GO:0043043 peptide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043604 amide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8475
MRLLSVTLTRPFLARPSPSLSPRCFSTLIPHRPTLALPTRMPIGAGFSPPASVADVVVPSNAVSSHPALAGLQLR
FGPRNTMVRATRLVQKRRHGYLTRLRTKNGRKILARRRAKGRKELSA
Coding >Ophio5|8475
ATGCGGCTACTTTCCGTCACACTTACCCGACCGTTTCTCGCCAGGCCTTCACCCTCACTAAGCCCAAGGTGCTTC
TCGACGCTTATTCCTCACCGGCCGACGCTCGCTCTCCCCACCCGCATGCCCATCGGAGCGGGCTTTTCACCTCCA
GCTTCTGTCGCCGATGTTGTCGTCCCCTCAAACGCCGTGTCGTCACACCCGGCGCTGGCGGGCCTGCAGCTGCGC
TTCGGGCCGCGAAATACAATGGTCAGGGCGACGCGTCTAGTGCAGAAGCGGCGGCATGGCTATCTCACCAGGTTG
CGGACCAAAAATGGCCGGAAGATCCTTGCGCGGAGGAGGGCAAAGGGAAGAAAGGAGCTTTCTGCT
Transcript >Ophio5|8475
ATGCGGCTACTTTCCGTCACACTTACCCGACCGTTTCTCGCCAGGCCTTCACCCTCACTAAGCCCAAGGTGCTTC
TCGACGCTTATTCCTCACCGGCCGACGCTCGCTCTCCCCACCCGCATGCCCATCGGAGCGGGCTTTTCACCTCCA
GCTTCTGTCGCCGATGTTGTCGTCCCCTCAAACGCCGTGTCGTCACACCCGGCGCTGGCGGGCCTGCAGCTGCGC
TTCGGGCCGCGAAATACAATGGTCAGGGCGACGCGTCTAGTGCAGAAGCGGCGGCATGGCTATCTCACCAGGTTG
CGGACCAAAAATGGCCGGAAGATCCTTGCGCGGAGGAGGGCAAAGGGAAGAAAGGAGCTTTCTGCTTAG
Gene >Ophio5|8475
ATGCGGCTACTTTCCGTCACACTTACCCGACCGTTTCTCGCCAGGCCTTCACCCTCACTAAGCCCAAGGTAGCGG
CATCTACTTTCTCGGCCCCCAGCTTCGACTGACCGAGTCGGCGCAGGTGCTTCTCGACGCTTATTCCTCACCGGC
CGACGCTCGCTCTCCCCACCCGCATGCCCATCGGAGCGGGCTTTTCACCTCCAGCTTCTGTCGCCGATGTTGTCG
TCCCCTCAAACGCCGTGTCGTCACACCCGGCGCTGGCGGGCCTGCAGCTGCGCTTCGGGCCGCGAAATACAATGG
TCAGGGCGACGCGTCTAGTGCAGAAGCGGCGGCATGGCTATCTCACCAGGTTGCGGACCAAAAATGGCCGGAAGA
TCCTTGCGCGGAGGAGGGCAAAGGGAAGAAAGGAGCTTTCTGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail