Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8468
Gene name
Locationscaffold_95:10244..14425
Strand-
Gene length (bp)4181
Transcript length (bp)4032
Coding sequence length (bp)4029
Protein length (aa) 1343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08623 TIP120 TATA-binding protein interacting (TIP20) 1.0E-65 1157 1321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BAH2|CAN1C_EMENI Cullin-associated NEDD8-dissociated protein 1, C-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=candA-C PE=1 SV=1 310 1334 0.0E+00
sp|Q86VP6|CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens GN=CAND1 PE=1 SV=2 18 1323 7.0E-150
sp|A7MBJ5|CAND1_BOVIN Cullin-associated NEDD8-dissociated protein 1 OS=Bos taurus GN=CAND1 PE=2 SV=1 18 1323 7.0E-150
sp|P97536|CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus GN=Cand1 PE=1 SV=1 18 1323 9.0E-150
sp|Q5R6L5|CAND1_PONAB Cullin-associated NEDD8-dissociated protein 1 OS=Pongo abelii GN=CAND1 PE=2 SV=1 18 1323 1.0E-149
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BAH2|CAN1C_EMENI Cullin-associated NEDD8-dissociated protein 1, C-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=candA-C PE=1 SV=1 310 1334 0.0E+00
sp|Q86VP6|CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens GN=CAND1 PE=1 SV=2 18 1323 7.0E-150
sp|A7MBJ5|CAND1_BOVIN Cullin-associated NEDD8-dissociated protein 1 OS=Bos taurus GN=CAND1 PE=2 SV=1 18 1323 7.0E-150
sp|P97536|CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus GN=Cand1 PE=1 SV=1 18 1323 9.0E-150
sp|Q5R6L5|CAND1_PONAB Cullin-associated NEDD8-dissociated protein 1 OS=Pongo abelii GN=CAND1 PE=2 SV=1 18 1323 1.0E-149
sp|Q6ZQ38|CAND1_MOUSE Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus GN=Cand1 PE=1 SV=2 18 1323 8.0E-149
sp|Q9VKY2|CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster GN=Cand1 PE=2 SV=1 18 1323 5.0E-144
sp|O75155|CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens GN=CAND2 PE=1 SV=3 18 1323 1.0E-127
sp|Q6ZQ73|CAND2_MOUSE Cullin-associated NEDD8-dissociated protein 2 OS=Mus musculus GN=Cand2 PE=1 SV=2 18 1315 2.0E-125
sp|Q8L5Y6|CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana GN=CAND1 PE=1 SV=1 25 1313 1.0E-124
sp|Q9R0L4|CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus GN=Cand2 PE=1 SV=1 29 1295 2.0E-115
sp|G5ED41|CAND1_CAEEL Cullin-associated NEDD8-dissociated protein 1 OS=Caenorhabditis elegans GN=cand-1 PE=1 SV=1 18 1325 3.0E-100
sp|Q86KD1|CAND1_DICDI Cullin-associated NEDD8-dissociated protein 1 OS=Dictyostelium discoideum GN=cand1 PE=3 SV=1 529 1320 4.0E-76
sp|C8VP82|CAN1N_EMENI Cullin-associated NEDD8-dissociated protein 1, N-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=candA-N PE=1 SV=1 20 307 3.0E-62
sp|Q86KD1|CAND1_DICDI Cullin-associated NEDD8-dissociated protein 1 OS=Dictyostelium discoideum GN=cand1 PE=3 SV=1 18 462 2.0E-26
sp|Q9P3A8|CAND1_SCHPO Cullin-associated NEDD8-dissociated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=knd1 PE=3 SV=1 991 1306 1.0E-16
sp|Q5ADW3|CAND1_CANAL Cullin-associated NEDD8-dissociated protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIP120 PE=3 SV=1 948 1329 8.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8468
MASPSPGATSPQAILAHVRKLGDADPDFRFMSLSDLLQLLAHSKPDLLHHDYNVAARTVDSIVKALDDQNSEVQN
LAIKCLGPLVAKVPPSILTPMMEKLSTLKLKNSVDNTVSSLALRSVITALPRPVPGLTVTGDVKHAYDVLQRVLI
PRLIGPDADTRTADDSLSLSPSSGNLLLDEDNINVEAVDVLIELVRCFGPMLQSVEVEAALHVVMQLLNSSKGTS
VVKKRSVVAISMLAVYLSDQQLDDVVQRLTSGLSQDGTNLMTRRLYISILGSMARSIPPRFGPHLSVAAPFVLHA
LSEGELEQHMAKVSDGDDANRDFNEVREASLVSLEAFLASCPQEMRQFTDDTMASALRYIKYDPNYAVDGDDDMD
VDDGGGEDDEDEDEAFDDDDGLDDDDDDDASWKVRRCAVKALYTLIATRGSGDLLENGVLYAQAAPMLIKRFDER
EENVRLEVISAMSLLIRKTGEGLHLPDVSLDDTEPEAATQMPLSRKRRRQSSGGSVSSSRFSAGTGLTSPVLDQI
PATGPRADLSRLIPSIVRASIKQLKGKTVATKQSIVNLLDDLVLVQRGGLSDFFSEIIGPVTDETKTSSGASSSS
LGSASATPSTLRMAALRLISDICRTHSSSLLQPFLSKMVAAVTLAVDDRFYKISSEAIRTVEELVKTMTPPRSRN
AGATYKTELEKLYEVMMVKSAAGDADAEVRQRAIHALGVLVSRTSTAEGAQLLSGNQRKAALEVLLDRLRNETTR
LAAVRAVDNVAAQALTAGQLDKAWIQQVALALCSQLRKANRTLRVSSVSALRHLVLCEAARDQLEPSTVEGIVSA
LMPAITDSDTHLLGPALLILAKMVQGYAQLVMTSDLTAALCKLLKSHFAVIVQEQLLELMGAIGRSGATRQLMRG
LLEDVSISGDPSVVGKVIGTLLVTGGSSTGVSLDSFVTELKSSAKSHDEARVSLALAVLGEVGMRLGAESPLEPD
LFLEQFHSEPDKVSLAAAIALGRAGSGDAPRFLPVILGTMKKGGNTQYLLIQSIKEILQSVSVRSTDLRDYALAI
WDELLKSCSNADNRVVCAECVGRLVMLDSGLFMPKLETLLRDSSSGIRGMAVQAVRYTLPENDEAFDAVLQKTLF
GMLLVMLQDSDMEIRRLAMSTLNSAVHNKPDLMLPHLGRLVPYVLSESVVKQELVKEVMLGPFKHTVDDGLEVRK
SAYETLYALMETAFTRISIVDLYDRVVAGLKDDNDIRQLCNLMVTKLMTLDADETMRRLDAIADAYRAVLSLKLK
DNAVKQDVEKQDEANKSVLRVSLLLGDRLKAVATSTSWAAYWEWVNKEFEKQLRGLREETKELQTRMV
Coding >Ophio5|8468
ATGGCGTCTCCCTCGCCTGGTGCTACATCGCCTCAGGCCATCTTGGCCCACGTCCGCAAGCTCGGCGATGCCGAC
CCGGACTTTCGCTTCATGTCTCTCAGCGACCTTCTGCAGCTCTTGGCCCACTCCAAGCCCGACCTTCTGCATCAT
GACTACAACGTAGCCGCGCGCACCGTCGATAGTATCGTCAAGGCGCTCGACGACCAGAATAGCGAGGTCCAGAAC
CTGGCAATCAAGTGTTTAGGTCCGCTGGTGGCCAAAGTCCCTCCTTCGATCCTGACGCCTATGATGGAGAAGCTG
TCGACGCTGAAACTCAAGAACTCGGTCGATAACACAGTATCTTCGTTGGCTCTCCGCTCTGTCATCACCGCTCTT
CCCCGTCCCGTCCCCGGCCTGACTGTGACGGGCGACGTCAAGCATGCCTACGATGTTCTCCAGCGCGTCCTCATC
CCACGTCTCATCGGGCCCGACGCCGACACGCGAACGGCCGATGATTCTCTCTCTCTGTCGCCATCATCTGGAAAC
TTGCTGCTGGACGAGGACAACATCAACGTCGAGGCTGTCGACGTTCTCATCGAGCTGGTCCGCTGCTTCGGTCCA
ATGTTGCAGTCGGTCGAGGTCGAGGCGGCCTTGCACGTCGTCATGCAGCTACTCAACAGCTCAAAGGGAACTTCG
GTCGTCAAGAAGCGCTCCGTCGTCGCCATCTCTATGCTTGCCGTCTACCTCTCCGATCAGCAGCTCGACGACGTC
GTCCAGAGGCTCACCTCGGGTCTCTCACAAGATGGCACCAACCTCATGACCCGTCGACTGTACATTTCTATTCTG
GGAAGCATGGCGAGGTCCATCCCGCCGCGCTTCGGACCTCATCTCTCCGTGGCCGCCCCCTTTGTTCTGCATGCG
CTGTCCGAAGGTGAGCTTGAGCAGCACATGGCCAAGGTCAGCGACGGCGACGATGCAAATCGGGACTTTAACGAG
GTGCGCGAAGCCTCGCTGGTCTCCCTCGAGGCCTTTCTGGCGTCATGCCCGCAGGAGATGCGCCAGTTTACTGAC
GACACGATGGCGTCGGCGCTCCGCTACATAAAATACGATCCCAACTACGCTGTCGACGGCGATGACGACATGGAC
GTAGATGACGGCGGCGGCGAGGACGATGAAGATGAAGATGAAGCTTTTGATGACGATGATGGTTTGGACGATGAT
GATGACGACGACGCCAGTTGGAAGGTCCGGCGTTGCGCCGTCAAGGCACTCTACACTCTCATCGCGACTCGGGGC
AGCGGCGACCTGCTGGAAAATGGTGTCCTCTATGCCCAGGCCGCGCCAATGCTCATCAAGCGCTTCGACGAAAGA
GAAGAGAACGTGCGTCTGGAGGTGATTTCGGCCATGTCACTGTTGATCCGCAAGACGGGTGAGGGCCTTCACCTG
CCAGATGTATCTCTTGATGACACGGAGCCCGAAGCAGCTACGCAGATGCCACTGAGCCGCAAGCGTAGGCGACAG
AGCAGCGGTGGCAGCGTCAGCTCATCGAGGTTCTCAGCCGGCACCGGCCTCACGTCTCCGGTACTGGACCAGATC
CCAGCCACAGGTCCCCGGGCCGACCTCTCGCGACTGATCCCCAGCATCGTCCGTGCCAGCATCAAGCAGCTCAAG
GGCAAGACGGTGGCGACGAAGCAGTCGATTGTCAACCTGCTAGACGATCTGGTGCTGGTGCAGCGCGGCGGGCTG
TCCGACTTTTTCTCCGAAATCATTGGGCCCGTAACGGACGAGACCAAGACGTCTTCGGGCGCGTCGTCGTCGTCG
CTGGGCTCGGCCTCGGCGACGCCCAGTACGCTGCGGATGGCGGCACTGCGGCTCATCAGCGACATTTGCAGGACG
CACTCGTCATCGCTCCTTCAGCCTTTCCTCTCCAAGATGGTGGCGGCGGTGACGTTGGCGGTGGACGATCGGTTC
TACAAGATATCCAGCGAGGCGATCCGGACGGTGGAGGAGCTCGTCAAGACGATGACGCCGCCCCGTTCGCGAAAC
GCTGGCGCCACATACAAGACGGAGCTGGAGAAGCTGTACGAGGTCATGATGGTCAAGAGCGCGGCCGGCGACGCC
GACGCCGAGGTACGACAGCGCGCCATTCACGCCCTGGGCGTGCTCGTGTCTCGGACATCAACGGCCGAGGGCGCG
CAGCTACTGTCGGGCAACCAGCGCAAGGCGGCGCTGGAGGTGCTACTGGATCGGCTGAGGAACGAGACGACGCGG
CTGGCAGCGGTCCGGGCGGTGGACAACGTGGCGGCCCAGGCGCTGACGGCCGGGCAGCTTGACAAGGCCTGGATC
CAGCAGGTGGCGCTGGCGCTCTGCTCGCAGCTCCGCAAGGCCAACCGGACGCTGAGGGTTTCGAGTGTGTCGGCG
CTGCGGCATCTGGTCCTGTGCGAGGCGGCGCGGGATCAGCTCGAGCCGTCGACGGTCGAGGGCATCGTTTCGGCG
CTGATGCCAGCCATCACGGACAGCGACACGCATCTGCTGGGGCCAGCGCTGCTGATTCTAGCCAAGATGGTGCAG
GGCTACGCGCAGCTGGTCATGACGAGCGACTTGACGGCGGCGTTGTGCAAGCTACTGAAATCGCACTTTGCCGTT
ATCGTCCAGGAGCAGCTGCTGGAGCTGATGGGCGCCATCGGGCGCAGCGGGGCCACGCGACAGCTGATGCGAGGC
CTTCTCGAAGACGTTAGTATCTCCGGAGATCCCTCGGTCGTCGGCAAAGTGATAGGCACGCTGCTGGTGACGGGA
GGCAGCTCGACGGGCGTGTCTCTCGACAGCTTCGTGACCGAGCTGAAATCGAGCGCCAAGTCACACGACGAGGCG
CGCGTCAGCCTGGCGCTGGCGGTGCTGGGCGAGGTCGGGATGCGACTCGGGGCCGAGTCGCCGCTGGAGCCGGAC
CTGTTCTTGGAGCAGTTCCATTCGGAGCCGGACAAGGTATCGCTGGCGGCCGCCATTGCGCTGGGACGGGCGGGC
TCGGGCGACGCGCCGCGTTTCCTGCCCGTGATACTCGGCACGATGAAGAAAGGGGGCAACACTCAGTATCTCCTG
ATTCAGTCCATCAAGGAGATTCTGCAGTCGGTGTCTGTGCGGTCGACGGATCTGCGCGACTATGCGCTGGCCATC
TGGGACGAGTTGCTCAAGTCGTGCTCCAACGCGGACAACCGGGTTGTTTGCGCCGAGTGTGTCGGGCGGCTGGTG
ATGCTGGATTCCGGCTTATTTATGCCGAAGCTGGAGACTCTCCTTCGCGACTCGTCGTCCGGCATCCGCGGCATG
GCTGTGCAGGCGGTGCGCTACACGCTACCGGAGAACGACGAGGCCTTTGACGCGGTGCTGCAGAAGACGCTGTTT
GGCATGCTACTGGTGATGCTGCAGGACTCGGATATGGAGATTCGGCGGCTGGCCATGTCGACGCTCAACTCGGCG
GTGCACAATAAGCCGGACCTGATGCTGCCGCACCTGGGGAGGCTGGTGCCGTACGTACTGAGCGAGTCGGTGGTG
AAGCAGGAGCTGGTCAAGGAGGTGATGCTGGGACCGTTTAAACACACGGTCGACGACGGGTTGGAGGTGCGCAAG
AGCGCATACGAGACTCTGTATGCCCTGATGGAGACGGCCTTTACACGCATCAGCATCGTCGACCTGTACGACCGC
GTGGTGGCGGGCCTCAAGGACGACAACGATATCCGGCAACTGTGCAACCTGATGGTGACCAAGCTCATGACGCTT
GATGCGGACGAGACGATGCGCAGGCTCGACGCCATCGCCGACGCCTACCGCGCCGTCTTGTCGCTCAAGCTCAAG
GACAACGCGGTCAAGCAGGACGTGGAGAAGCAGGACGAGGCCAACAAGAGCGTCCTGCGTGTGTCTCTCCTCTTG
GGCGACCGGCTCAAGGCGGTGGCGACGAGCACCTCGTGGGCTGCGTATTGGGAGTGGGTGAATAAGGAGTTTGAG
AAGCAGCTCAGGGGGCTGCGGGAGGAGACGAAGGAGTTGCAGACGAGGATGGTC
Transcript >Ophio5|8468
ATGGCGTCTCCCTCGCCTGGTGCTACATCGCCTCAGGCCATCTTGGCCCACGTCCGCAAGCTCGGCGATGCCGAC
CCGGACTTTCGCTTCATGTCTCTCAGCGACCTTCTGCAGCTCTTGGCCCACTCCAAGCCCGACCTTCTGCATCAT
GACTACAACGTAGCCGCGCGCACCGTCGATAGTATCGTCAAGGCGCTCGACGACCAGAATAGCGAGGTCCAGAAC
CTGGCAATCAAGTGTTTAGGTCCGCTGGTGGCCAAAGTCCCTCCTTCGATCCTGACGCCTATGATGGAGAAGCTG
TCGACGCTGAAACTCAAGAACTCGGTCGATAACACAGTATCTTCGTTGGCTCTCCGCTCTGTCATCACCGCTCTT
CCCCGTCCCGTCCCCGGCCTGACTGTGACGGGCGACGTCAAGCATGCCTACGATGTTCTCCAGCGCGTCCTCATC
CCACGTCTCATCGGGCCCGACGCCGACACGCGAACGGCCGATGATTCTCTCTCTCTGTCGCCATCATCTGGAAAC
TTGCTGCTGGACGAGGACAACATCAACGTCGAGGCTGTCGACGTTCTCATCGAGCTGGTCCGCTGCTTCGGTCCA
ATGTTGCAGTCGGTCGAGGTCGAGGCGGCCTTGCACGTCGTCATGCAGCTACTCAACAGCTCAAAGGGAACTTCG
GTCGTCAAGAAGCGCTCCGTCGTCGCCATCTCTATGCTTGCCGTCTACCTCTCCGATCAGCAGCTCGACGACGTC
GTCCAGAGGCTCACCTCGGGTCTCTCACAAGATGGCACCAACCTCATGACCCGTCGACTGTACATTTCTATTCTG
GGAAGCATGGCGAGGTCCATCCCGCCGCGCTTCGGACCTCATCTCTCCGTGGCCGCCCCCTTTGTTCTGCATGCG
CTGTCCGAAGGTGAGCTTGAGCAGCACATGGCCAAGGTCAGCGACGGCGACGATGCAAATCGGGACTTTAACGAG
GTGCGCGAAGCCTCGCTGGTCTCCCTCGAGGCCTTTCTGGCGTCATGCCCGCAGGAGATGCGCCAGTTTACTGAC
GACACGATGGCGTCGGCGCTCCGCTACATAAAATACGATCCCAACTACGCTGTCGACGGCGATGACGACATGGAC
GTAGATGACGGCGGCGGCGAGGACGATGAAGATGAAGATGAAGCTTTTGATGACGATGATGGTTTGGACGATGAT
GATGACGACGACGCCAGTTGGAAGGTCCGGCGTTGCGCCGTCAAGGCACTCTACACTCTCATCGCGACTCGGGGC
AGCGGCGACCTGCTGGAAAATGGTGTCCTCTATGCCCAGGCCGCGCCAATGCTCATCAAGCGCTTCGACGAAAGA
GAAGAGAACGTGCGTCTGGAGGTGATTTCGGCCATGTCACTGTTGATCCGCAAGACGGGTGAGGGCCTTCACCTG
CCAGATGTATCTCTTGATGACACGGAGCCCGAAGCAGCTACGCAGATGCCACTGAGCCGCAAGCGTAGGCGACAG
AGCAGCGGTGGCAGCGTCAGCTCATCGAGGTTCTCAGCCGGCACCGGCCTCACGTCTCCGGTACTGGACCAGATC
CCAGCCACAGGTCCCCGGGCCGACCTCTCGCGACTGATCCCCAGCATCGTCCGTGCCAGCATCAAGCAGCTCAAG
GGCAAGACGGTGGCGACGAAGCAGTCGATTGTCAACCTGCTAGACGATCTGGTGCTGGTGCAGCGCGGCGGGCTG
TCCGACTTTTTCTCCGAAATCATTGGGCCCGTAACGGACGAGACCAAGACGTCTTCGGGCGCGTCGTCGTCGTCG
CTGGGCTCGGCCTCGGCGACGCCCAGTACGCTGCGGATGGCGGCACTGCGGCTCATCAGCGACATTTGCAGGACG
CACTCGTCATCGCTCCTTCAGCCTTTCCTCTCCAAGATGGTGGCGGCGGTGACGTTGGCGGTGGACGATCGGTTC
TACAAGATATCCAGCGAGGCGATCCGGACGGTGGAGGAGCTCGTCAAGACGATGACGCCGCCCCGTTCGCGAAAC
GCTGGCGCCACATACAAGACGGAGCTGGAGAAGCTGTACGAGGTCATGATGGTCAAGAGCGCGGCCGGCGACGCC
GACGCCGAGGTACGACAGCGCGCCATTCACGCCCTGGGCGTGCTCGTGTCTCGGACATCAACGGCCGAGGGCGCG
CAGCTACTGTCGGGCAACCAGCGCAAGGCGGCGCTGGAGGTGCTACTGGATCGGCTGAGGAACGAGACGACGCGG
CTGGCAGCGGTCCGGGCGGTGGACAACGTGGCGGCCCAGGCGCTGACGGCCGGGCAGCTTGACAAGGCCTGGATC
CAGCAGGTGGCGCTGGCGCTCTGCTCGCAGCTCCGCAAGGCCAACCGGACGCTGAGGGTTTCGAGTGTGTCGGCG
CTGCGGCATCTGGTCCTGTGCGAGGCGGCGCGGGATCAGCTCGAGCCGTCGACGGTCGAGGGCATCGTTTCGGCG
CTGATGCCAGCCATCACGGACAGCGACACGCATCTGCTGGGGCCAGCGCTGCTGATTCTAGCCAAGATGGTGCAG
GGCTACGCGCAGCTGGTCATGACGAGCGACTTGACGGCGGCGTTGTGCAAGCTACTGAAATCGCACTTTGCCGTT
ATCGTCCAGGAGCAGCTGCTGGAGCTGATGGGCGCCATCGGGCGCAGCGGGGCCACGCGACAGCTGATGCGAGGC
CTTCTCGAAGACGTTAGTATCTCCGGAGATCCCTCGGTCGTCGGCAAAGTGATAGGCACGCTGCTGGTGACGGGA
GGCAGCTCGACGGGCGTGTCTCTCGACAGCTTCGTGACCGAGCTGAAATCGAGCGCCAAGTCACACGACGAGGCG
CGCGTCAGCCTGGCGCTGGCGGTGCTGGGCGAGGTCGGGATGCGACTCGGGGCCGAGTCGCCGCTGGAGCCGGAC
CTGTTCTTGGAGCAGTTCCATTCGGAGCCGGACAAGGTATCGCTGGCGGCCGCCATTGCGCTGGGACGGGCGGGC
TCGGGCGACGCGCCGCGTTTCCTGCCCGTGATACTCGGCACGATGAAGAAAGGGGGCAACACTCAGTATCTCCTG
ATTCAGTCCATCAAGGAGATTCTGCAGTCGGTGTCTGTGCGGTCGACGGATCTGCGCGACTATGCGCTGGCCATC
TGGGACGAGTTGCTCAAGTCGTGCTCCAACGCGGACAACCGGGTTGTTTGCGCCGAGTGTGTCGGGCGGCTGGTG
ATGCTGGATTCCGGCTTATTTATGCCGAAGCTGGAGACTCTCCTTCGCGACTCGTCGTCCGGCATCCGCGGCATG
GCTGTGCAGGCGGTGCGCTACACGCTACCGGAGAACGACGAGGCCTTTGACGCGGTGCTGCAGAAGACGCTGTTT
GGCATGCTACTGGTGATGCTGCAGGACTCGGATATGGAGATTCGGCGGCTGGCCATGTCGACGCTCAACTCGGCG
GTGCACAATAAGCCGGACCTGATGCTGCCGCACCTGGGGAGGCTGGTGCCGTACGTACTGAGCGAGTCGGTGGTG
AAGCAGGAGCTGGTCAAGGAGGTGATGCTGGGACCGTTTAAACACACGGTCGACGACGGGTTGGAGGTGCGCAAG
AGCGCATACGAGACTCTGTATGCCCTGATGGAGACGGCCTTTACACGCATCAGCATCGTCGACCTGTACGACCGC
GTGGTGGCGGGCCTCAAGGACGACAACGATATCCGGCAACTGTGCAACCTGATGGTGACCAAGCTCATGACGCTT
GATGCGGACGAGACGATGCGCAGGCTCGACGCCATCGCCGACGCCTACCGCGCCGTCTTGTCGCTCAAGCTCAAG
GACAACGCGGTCAAGCAGGACGTGGAGAAGCAGGACGAGGCCAACAAGAGCGTCCTGCGTGTGTCTCTCCTCTTG
GGCGACCGGCTCAAGGCGGTGGCGACGAGCACCTCGTGGGCTGCGTATTGGGAGTGGGTGAATAAGGAGTTTGAG
AAGCAGCTCAGGGGGCTGCGGGAGGAGACGAAGGAGTTGCAGACGAGGATGGTCTAG
Gene >Ophio5|8468
ATGGCGTCTCCCTCGCCTGGTGCTACATCGCCTCAGGCCATCTTGGCCCACGTCCGCAAGCTCGGCGATGCCGAC
CCGGACTTTCGCTTCATGTCTCTCAGCGACCTTCTGCAGCTCTTGGCCCACTCCAAGCCCGACCTTCTGCATCAT
GACTACAACGTAGCCGCGCGCACCGTCGATAGTATCGTCAAGGCGCTCGACGACCAGAATAGCGAGGTCCAGAAC
CTGGCAATCAAGTGGTGAGACGAGCCCGTCGTCAGTGCGTTACTCAGCGACTGACGTGCTGCAGTTTAGGTCCGC
TGGTGGCCAAAGTCCCTCCTTCGATCCTGACGCCTATGATGGAGAAGCTGTCGACGCTGAAACTCAAGAACTCGG
TCGATAACACAGTATCTTCGTTGGCTCTCCGCTCTGTCATCACCGCTCTTCCCCGTCCCGTCCCCGGCCTGACTG
TGACGGGCGACGTCAAGCATGCCTACGATGTTCTCCAGCGCGTCCTCATCCCACGTCTCATCGGGCCCGACGCCG
ACACGCGAACGGCCGATGATTCTCTCTCTCTGTCGCCATCATCTGGAAACTTGCTGCTGGACGAGGACAACATCA
ACGTCGAGGCTGTCGACGTTCTCATCGAGCTGGTCCGCTGCTTCGGTCCAATGTTGCAGTCGGTCGAGGTCGAGG
CGGCCTTGCACGTCGTCATGCAGCTACTCAACAGCTCAAAGGGAACTTCGGTCGTCAAGAAGCGCTCCGTCGTCG
CCATCTCTATGCTTGCCGTCTACCTCTCCGATCAGCAGCTCGACGACGTCGTCCAGAGGCTCACCTCGGGTCTCT
CACAAGATGGCACCAACCTCATGACCCGTCGACTGTACATTTCTATTCTGGGAAGCATGGCGAGGTCCATCCCGC
CGCGCTTCGGACCTCATCTCTCCGTGGCCGCCCCCTTTGTTCTGCATGCGCTGTCCGAAGGTGAGCTTGAGCAGC
ACATGGCCAAGGTCAGCGACGGCGACGATGCAAATCGGGACTTTAACGAGGTGCGCGAAGCCTCGCTGGTCTCCC
TCGAGGCCTTTCTGGCGTCATGCCCGCAGGAGATGCGCCAGTTTACTGACGACACGATGGCGTCGGCGCTCCGCT
ACATAAAATACGATCCCAACTACGCTGTCGACGGCGATGACGACATGGACGTAGATGACGGCGGCGGCGAGGACG
ATGAAGATGAAGATGAAGCTTTTGATGACGATGATGGTTTGGACGATGATGATGACGACGACGCCAGTTGGAAGG
TCCGGCGTTGCGCCGTCAAGGCACTCTACACTCTCATCGCGACTCGGGGCAGCGGCGACCTGCTGGAAAATGGTG
TCCTCTATGCCCAGGCCGCGCCAATGCTCATCAAGCGCTTCGACGAAAGAGAAGAGAACGTGCGTCTGGAGGTGA
TTTCGGCCATGTCACTGTTGATCCGCAAGACGGGTGAGGGCCTTCACCTGCCAGATGTATCTCTTGATGACACGG
AGCCCGAAGCAGCTACGCAGATGCCACTGAGCCGCAAGCGTAGGCGACAGAGCAGCGGTGGCAGCGTCAGCTCAT
CGAGGTTCTCAGCCGGCACCGGCCTCACGTCTCCGGTACTGGACCAGATCCCAGCCACAGGTCCCCGGGCCGACC
TCTCGCGACTGATCCCCAGCATCGTCCGTGCCAGCATCAAGCAGCTCAAGGGCAAGACGGTGGCGACGAAGCAGT
CGATTGTCAACCTGCTAGACGATCTGGTGCTGGTGCAGCGCGGCGGGCTGTCCGACTTTTTCTCCGAAATCATTG
GGCCCGTAACGGACGAGACCAAGACGTCTTCGGGCGCGTCGTCGTCGTCGCTGGGCTCGGCCTCGGCGACGCCCA
GTACGCTGCGGATGGCGGCACTGCGGCTCATCAGCGACATTTGCAGGACGCACTCGTCATCGCTCCTTCAGCCTT
TCCTCTCCAAGATGGTGGCGGCGGTGACGTTGGCGGTGGACGATCGGTTCTACAAGATATCCAGCGAGGCGATCC
GGACGGTGGAGGAGCTCGTCAAGACGATGACGCCGCCCCGTTCGCGAAACGCTGGCGCCACATACAAGACGGAGC
TGGAGAAGCTGTACGAGGTCATGATGGTCAAGAGCGCGGCCGGCGACGCCGACGCCGAGGTACGACAGCGCGCCA
TTCACGCCCTGGGCGTGCTCGTGTCTCGGACATCAACGGCCGAGGGCGCGCAGCTACTGTCGGGCAACCAGCGCA
AGGCGGCGCTGGAGGTGCTACTGGATCGGCTGAGGAACGAGACGACGCGGCTGGCAGCGGTCCGGGCGGTGGACA
ACGTGGCGGCCCAGGCGCTGACGGCCGGGCAGCTTGACAAGGCCTGGATCCAGCAGGTGGCGCTGGCGCTCTGCT
CGCAGCTCCGCAAGGCCAACCGGACGCTGAGGGTTTCGAGTGTGTCGGCGCTGCGGCATCTGGTCCTGTGCGAGG
CGGCGCGGGATCAGCTCGAGCCGTCGACGGTCGAGGGCATCGTTTCGGCGCTGATGCCAGCCATCACGGACAGCG
ACACGCATCTGCTGGGGCCAGCGCTGCTGATTCTAGCCAAGATGGTGCAGGGCTACGCGCAGCTGGTCATGACGA
GCGACTTGACGGCGGCGTTGTGCAAGCTACTGAAATCGCACTTTGCCGTTATCGTCCAGGAGCAGCTGCTGGAGC
TGATGGGCGCCATCGGGCGCAGCGGGGCCACGCGACAGCTGATGCGAGGCCTTCTCGAAGACGTTAGTATCTCCG
GAGATCCCTCGGTCGTCGGCAAAGTGATAGGCACGCTGCTGGTGACGGGAGGCAGCTCGACGGGCGTGTCTCTCG
ACAGCTTCGTGACCGAGCTGAAATCGAGCGCCAAGTCACACGACGAGGCGCGCGTCAGCCTGGCGCTGGCGGTGC
TGGGCGAGGTCGGGATGCGACTCGGGGCCGAGTCGCCGCTGGAGCCGGACCTGTTCTTGGAGCAGTTCCATTCGG
AGCCGGACAAGGTATCGCTGGCGGCCGCCATTGCGCTGGGACGGGCGGGCTCGGGCGACGCGCCGCGTTTCCTGC
CCGTGATACTCGGCACGATGAAGAAAGGGGGCAACACTCAGTATCTCCTGATTCAGTCCATCAAGGAGATTCTGC
AGTCGGTGTCTGTGCGGTCGACGGATCTGCGCGACTATGCGCTGGCCATCTGGGACGAGTTGCTCAAGTCGTGCT
CCAACGCGGACAACCGGGTTGTTTGCGCCGAGTGTGTCGGGCGGCTGGTGATGCTGGATTCCGGCTTATTTATGC
CGAAGCTGGAGGTGTGTTTCTTCCCTCTCCTTTTCTTATCAAGTCTTCTAACATCTGCAGACTCTCCTTCGCGAC
TCGTCGTCCGGCATCCGCGGCATGGCTGTGCAGGCGGTGCGCTACACGCTACCGGAGAACGACGAGGCCTTTGAC
GCGGTGCTGCAGAAGACGCTGTTTGGCATGCTACTGGTGATGCTGCAGGACTCGGATATGGAGATTCGGCGGCTG
GCCATGTCGACGCTCAACTCGGCGGTGCACAATAAGCCGGACCTGATGCTGCCGCACCTGGGGAGGCTGGTGCCG
TACGTACTGAGCGAGTCGGTGGTGAAGCAGGAGCTGGTCAAGGAGGTGATGCTGGGACCGTTTAAACACACGGTC
GACGACGGGTTGGAGGTGCGCAAGGCGAGTATCTCCGCCTCGGAATGACAAGTGTGTAGGCTGACGGCGAGCAGA
GCGCATACGAGACTCTGTATGCCCTGATGGAGACGGCCTTTACACGCATCAGCATCGTCGACCTGTACGACCGCG
TGGTGGCGGGCCTCAAGGACGACAACGATATCCGGCAACTGTGCAACCTGATGGTGACCAAGCTCATGACGCTTG
ATGCGGACGAGACGATGCGCAGGCTCGACGCCATCGCCGACGCCTACCGCGCCGTCTTGTCGCTCAAGCTCAAGG
ACAACGCGGTCAAGCAGGACGTGGAGAAGCAGGACGAGGCCAACAAGAGCGTCCTGCGTGTGTCTCTCCTCTTGG
GCGACCGGCTCAAGGCGGTGGCGACGAGCACCTCGTGGGCTGCGTATTGGGAGTGGGTGAATAAGGAGTTTGAGA
AGCAGCTCAGGGGGCTGCGGGAGGAGACGAAGGAGTTGCAGACGAGGATGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail