Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8464
Gene name
Locationscaffold_95:3993..4349
Strand-
Gene length (bp)356
Transcript length (bp)303
Coding sequence length (bp)300
Protein length (aa) 100

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 76 98 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 19.03 2.88 35.17
CcL In ants, during behavior modification 10.52 0.00 21.07
CcD In ants, recently dead 4.97 0.00 11.19

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.222972 no
SC16a CcD 0.023550 yes
CcL CcD 0.213032 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8464
MAACAARVDDCRYPIGDELAQCLRRAVSVDFSVDEACHYGAVGAVDFRVGRRTFGDDVAGTMFKPERRWASRSCQ
GGFAFLVYIAQPFALIFIPFCHIRW
Coding >Ophio5|8464
ATGGCTGCTTGCGCTGCTCGAGTCGACGACTGTCGTTACCCCATAGGCGACGAACTGGCCCAGTGCCTGCGTCGA
GCCGTGAGTGTCGACTTTAGCGTCGATGAGGCCTGCCATTATGGTGCAGTCGGTGCCGTCGATTTCCGAGTCGGC
CGGCGTACTTTCGGAGACGACGTTGCCGGGACTATGTTCAAACCTGAGAGACGATGGGCATCGCGATCTTGTCAA
GGTGGATTTGCTTTCTTAGTCTACATTGCACAGCCTTTTGCTCTGATATTTATACCCTTCTGCCATATTCGTTGG
Transcript >Ophio5|8464
ATGGCTGCTTGCGCTGCTCGAGTCGACGACTGTCGTTACCCCATAGGCGACGAACTGGCCCAGTGCCTGCGTCGA
GCCGTGAGTGTCGACTTTAGCGTCGATGAGGCCTGCCATTATGGTGCAGTCGGTGCCGTCGATTTCCGAGTCGGC
CGGCGTACTTTCGGAGACGACGTTGCCGGGACTATGTTCAAACCTGAGAGACGATGGGCATCGCGATCTTGTCAA
GGTGGATTTGCTTTCTTAGTCTACATTGCACAGCCTTTTGCTCTGATATTTATACCCTTCTGCCATATTCGTTGG
TAG
Gene >Ophio5|8464
ATGGCTGCTTGCGCTGCTCGAGTCGACGACTGTCGTTACCCCATAGGCGACGAACTGGCCCAGTGCCTGCGTCGA
GCCGTGAGTGTCGACTTTAGCGTCGATGAGGCCTGCCATTATGGTGCAGTCGGTGCCGTCGATTTCCGAGTCGGC
CGGCGTACTTTCGGAGACGACGTTGCCGGGACTATGTTCAAACCTGAGGTTGCTACCGTTTTCCATGCCGTCGAT
GCGCAGAACACTGACGTTGCGGACAGAGACGATGGGCATCGCGATCTTGTCAAGGTGGATTTGCTTTCTTAGTCT
ACATTGCACAGCCTTTTGCTCTGATATTTATACCCTTCTGCCATATTCGTTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail