Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|846
Gene name
Locationscaffold_1249:510..2055
Strand+
Gene length (bp)1545
Transcript length (bp)1443
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03348 Serinc Serine incorporator (Serinc) 1.5E-167 23 476

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12116|TMS1_YEAST Membrane protein TMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMS1 PE=1 SV=1 1 479 4.0E-139
sp|Q9HDY3|YK17_SCHPO Membrane protein PB1A10.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.07c PE=3 SV=1 1 477 4.0E-101
sp|A7S4N4|SERIC_NEMVE Probable serine incorporator OS=Nematostella vectensis GN=serinc PE=3 SV=1 23 480 3.0E-74
sp|Q5R533|SERC3_PONAB Serine incorporator 3 OS=Pongo abelii GN=SERINC3 PE=2 SV=1 11 480 2.0E-68
sp|Q13530|SERC3_HUMAN Serine incorporator 3 OS=Homo sapiens GN=SERINC3 PE=2 SV=2 11 480 4.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12116|TMS1_YEAST Membrane protein TMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMS1 PE=1 SV=1 1 479 4.0E-139
sp|Q9HDY3|YK17_SCHPO Membrane protein PB1A10.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.07c PE=3 SV=1 1 477 4.0E-101
sp|A7S4N4|SERIC_NEMVE Probable serine incorporator OS=Nematostella vectensis GN=serinc PE=3 SV=1 23 480 3.0E-74
sp|Q5R533|SERC3_PONAB Serine incorporator 3 OS=Pongo abelii GN=SERINC3 PE=2 SV=1 11 480 2.0E-68
sp|Q13530|SERC3_HUMAN Serine incorporator 3 OS=Homo sapiens GN=SERINC3 PE=2 SV=2 11 480 4.0E-68
sp|Q9QZI8|SERC1_MOUSE Serine incorporator 1 OS=Mus musculus GN=Serinc1 PE=1 SV=1 11 478 6.0E-68
sp|Q7TNK0|SERC1_RAT Serine incorporator 1 OS=Rattus norvegicus GN=Serinc1 PE=1 SV=1 11 478 1.0E-67
sp|Q9NRX5|SERC1_HUMAN Serine incorporator 1 OS=Homo sapiens GN=SERINC1 PE=1 SV=1 1 478 1.0E-63
sp|Q5R419|SERC1_PONAB Serine incorporator 1 OS=Pongo abelii GN=SERINC1 PE=2 SV=1 1 478 2.0E-63
sp|Q3MHV9|SERC1_BOVIN Serine incorporator 1 OS=Bos taurus GN=SERINC1 PE=2 SV=1 1 478 2.0E-63
sp|A4FUZ5|SERC3_BOVIN Serine incorporator 3 OS=Bos taurus GN=SERINC3 PE=2 SV=1 11 480 3.0E-62
sp|Q54UF8|SERIC_DICDI Probable serine incorporator OS=Dictyostelium discoideum GN=serinc PE=3 SV=1 43 427 1.0E-54
sp|A9UY97|SERIC_MONBE Probable serine incorporator OS=Monosiga brevicollis GN=serinc PE=3 SV=1 23 480 2.0E-54
sp|Q9QZI9|SERC3_MOUSE Serine incorporator 3 OS=Mus musculus GN=Serinc3 PE=1 SV=2 11 480 4.0E-50
sp|Q96SA4|SERC2_HUMAN Serine incorporator 2 OS=Homo sapiens GN=SERINC2 PE=2 SV=3 17 480 3.0E-49
sp|Q8K0E7|SERC2_MOUSE Serine incorporator 2 OS=Mus musculus GN=Serinc2 PE=2 SV=1 17 480 2.0E-48
sp|Q8BHJ6|SERC5_MOUSE Serine incorporator 5 OS=Mus musculus GN=Serinc5 PE=2 SV=1 23 476 2.0E-47
sp|Q58CW5|SERC2_BOVIN Serine incorporator 2 OS=Bos taurus GN=SERINC2 PE=2 SV=1 17 480 4.0E-43
sp|Q803X0|SERC5_DANRE Serine incorporator 5 OS=Danio rerio GN=serinc5 PE=2 SV=1 23 478 8.0E-43
sp|Q63175|SERC5_RAT Serine incorporator 5 OS=Rattus norvegicus GN=Serinc5 PE=2 SV=1 23 476 9.0E-42
sp|Q4R6L9|SERC5_MACFA Serine incorporator 5 OS=Macaca fascicularis GN=SERINC5 PE=2 SV=1 93 480 9.0E-41
sp|Q86VE9|SERC5_HUMAN Serine incorporator 5 OS=Homo sapiens GN=SERINC5 PE=2 SV=1 23 427 3.0E-38
sp|A6NH21|SERC4_HUMAN Serine incorporator 4 OS=Homo sapiens GN=SERINC4 PE=2 SV=1 25 459 4.0E-33
sp|A8WCG0|SERC4_RAT Serine incorporator 4 OS=Rattus norvegicus GN=Serinc4 PE=2 SV=2 21 459 1.0E-26
sp|Q5XK03|SERC4_MOUSE Serine incorporator 4 OS=Mus musculus GN=Serinc4 PE=2 SV=1 23 459 1.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 49 71 22
3 96 118 22
4 131 150 19
5 160 179 19
6 200 222 22
7 237 254 17
8 308 330 22
9 408 430 22
10 451 473 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|846
MGAALSLPALAVPSIGSIMSFAATCCGAATCSMVCRAWGKCGNSVATRIAYAFLLLVNSILAWMMLTPWAIEKLQ
HLTLDYVKINCPTGQCYGWLAVHRINFALGLLHLLLAGLLLGVKSSRGSRAALQNGFWGPKLIIWVVLIVAAFLI
PDRFFMFYGNYVSLVCAMLFLLLGLILLVDLAHNWAEYCLAQIESRDSRLWRSILIGSTLGMYLASVAMTVVQFV
FFAKGDCSMNQAVISINLALWVTVSLVSVNSTVQEHNPRAGLAQAAMVAAYCTYLTMSAVSMEPDGDNQCNPLIR
GQETRTTSVIIGAIVTMLTIAYTTTRAATQSLGLGSSDGAIRLPEDADDQHDLVIHQPAARREMRAEALRRAIEE
GSLPADAALSDMDSDATGASEHDDERSRTQYNYTIFHIIFFLATAWVSTLLTLKYEETKQDGDFATVGRTYAASW
VKIVSAWTCYGLYIWTLTAPIVLPERFDFS
Coding >Ophio5|846
ATGGGGGCGGCTTTATCTTTGCCGGCTCTCGCTGTGCCGAGCATAGGTTCTATCATGTCTTTCGCCGCAACGTGC
TGTGGAGCGGCGACGTGCTCTATGGTTTGCCGCGCGTGGGGCAAGTGTGGCAACAGCGTGGCCACCCGCATCGCA
TACGCCTTCCTTCTTCTTGTCAATTCCATTCTCGCCTGGATGATGCTCACGCCATGGGCCATCGAAAAGCTGCAG
CATCTAACGCTAGATTACGTCAAAATCAACTGTCCCACTGGTCAATGTTACGGCTGGCTAGCCGTCCATCGGATC
AACTTTGCCCTCGGACTCCTCCATCTACTTCTAGCCGGCCTGCTTCTCGGCGTTAAATCGTCCCGAGGTTCCCGT
GCCGCTCTGCAGAATGGGTTTTGGGGCCCCAAGCTCATCATATGGGTGGTTCTCATCGTCGCCGCCTTCTTGATC
CCAGACAGATTCTTCATGTTTTACGGCAATTATGTGTCTCTCGTTTGCGCGATGCTGTTTCTTCTTCTAGGCCTG
ATTCTACTGGTTGATCTCGCCCACAACTGGGCTGAATACTGTCTGGCACAGATTGAAAGCAGAGACTCGAGGTTG
TGGCGCTCTATCCTCATCGGATCAACCCTCGGCATGTATCTGGCATCCGTCGCCATGACGGTGGTTCAGTTCGTT
TTCTTTGCCAAGGGAGATTGTTCCATGAATCAGGCCGTCATCAGCATCAATCTAGCGCTCTGGGTCACCGTTTCC
CTTGTCTCTGTTAATTCGACCGTTCAAGAGCATAACCCACGCGCAGGACTCGCTCAGGCGGCCATGGTCGCCGCA
TATTGCACGTATCTGACCATGTCGGCGGTGTCGATGGAGCCCGACGGCGACAACCAATGTAATCCTTTAATTCGC
GGTCAGGAAACGAGGACAACTTCTGTCATCATCGGCGCTATCGTGACTATGCTGACCATAGCATACACAACAACA
CGCGCCGCTACGCAGAGCCTGGGACTTGGGTCTTCAGATGGTGCCATTCGACTTCCCGAAGATGCTGACGATCAG
CACGACCTTGTCATTCATCAGCCGGCCGCTCGACGCGAGATGCGGGCTGAGGCATTACGTCGCGCGATCGAGGAA
GGCAGTCTTCCGGCTGATGCCGCGCTGTCAGACATGGACAGTGACGCCACCGGAGCATCAGAGCATGATGACGAG
CGCTCTCGCACTCAGTACAACTATACCATTTTCCACATCATCTTCTTCCTGGCCACTGCGTGGGTATCTACTTTA
CTCACACTCAAGTACGAGGAAACGAAGCAAGACGGCGACTTTGCAACTGTTGGTCGAACGTACGCCGCAAGCTGG
GTCAAGATTGTCAGCGCTTGGACATGTTATGGCCTGTACATCTGGACATTGACGGCTCCAATTGTATTGCCTGAG
AGGTTCGACTTCTCT
Transcript >Ophio5|846
ATGGGGGCGGCTTTATCTTTGCCGGCTCTCGCTGTGCCGAGCATAGGTTCTATCATGTCTTTCGCCGCAACGTGC
TGTGGAGCGGCGACGTGCTCTATGGTTTGCCGCGCGTGGGGCAAGTGTGGCAACAGCGTGGCCACCCGCATCGCA
TACGCCTTCCTTCTTCTTGTCAATTCCATTCTCGCCTGGATGATGCTCACGCCATGGGCCATCGAAAAGCTGCAG
CATCTAACGCTAGATTACGTCAAAATCAACTGTCCCACTGGTCAATGTTACGGCTGGCTAGCCGTCCATCGGATC
AACTTTGCCCTCGGACTCCTCCATCTACTTCTAGCCGGCCTGCTTCTCGGCGTTAAATCGTCCCGAGGTTCCCGT
GCCGCTCTGCAGAATGGGTTTTGGGGCCCCAAGCTCATCATATGGGTGGTTCTCATCGTCGCCGCCTTCTTGATC
CCAGACAGATTCTTCATGTTTTACGGCAATTATGTGTCTCTCGTTTGCGCGATGCTGTTTCTTCTTCTAGGCCTG
ATTCTACTGGTTGATCTCGCCCACAACTGGGCTGAATACTGTCTGGCACAGATTGAAAGCAGAGACTCGAGGTTG
TGGCGCTCTATCCTCATCGGATCAACCCTCGGCATGTATCTGGCATCCGTCGCCATGACGGTGGTTCAGTTCGTT
TTCTTTGCCAAGGGAGATTGTTCCATGAATCAGGCCGTCATCAGCATCAATCTAGCGCTCTGGGTCACCGTTTCC
CTTGTCTCTGTTAATTCGACCGTTCAAGAGCATAACCCACGCGCAGGACTCGCTCAGGCGGCCATGGTCGCCGCA
TATTGCACGTATCTGACCATGTCGGCGGTGTCGATGGAGCCCGACGGCGACAACCAATGTAATCCTTTAATTCGC
GGTCAGGAAACGAGGACAACTTCTGTCATCATCGGCGCTATCGTGACTATGCTGACCATAGCATACACAACAACA
CGCGCCGCTACGCAGAGCCTGGGACTTGGGTCTTCAGATGGTGCCATTCGACTTCCCGAAGATGCTGACGATCAG
CACGACCTTGTCATTCATCAGCCGGCCGCTCGACGCGAGATGCGGGCTGAGGCATTACGTCGCGCGATCGAGGAA
GGCAGTCTTCCGGCTGATGCCGCGCTGTCAGACATGGACAGTGACGCCACCGGAGCATCAGAGCATGATGACGAG
CGCTCTCGCACTCAGTACAACTATACCATTTTCCACATCATCTTCTTCCTGGCCACTGCGTGGGTATCTACTTTA
CTCACACTCAAGTACGAGGAAACGAAGCAAGACGGCGACTTTGCAACTGTTGGTCGAACGTACGCCGCAAGCTGG
GTCAAGATTGTCAGCGCTTGGACATGTTATGGCCTGTACATCTGGACATTGACGGCTCCAATTGTATTGCCTGAG
AGGTTCGACTTCTCTTAG
Gene >Ophio5|846
ATGGGGGCGGCTTTATCTTTGCCGGCTCTCGCTGTGCCGAGCATAGGTTCTGTATGCTGTTCCATCCCTCCCGCG
ATCTTGAACGCGGCTCACTTCGCCTTCAGATCATGTCTTTCGCCGCAACGTGCTGTGGAGCGGCGACGTGCTCTA
TGGTTTGCCGCGCGTGGGGCAAGTGTGGCAACAGGTATGATGGGCTCTACCTATTACTGGCGTTGCTTAACCTCC
CTGTGAAGCGTGGCCACCCGCATCGCATACGCCTTCCTTCTTCTTGTCAATTCCATTCTCGCCTGGATGATGCTC
ACGCCATGGGCCATCGAAAAGCTGCAGCATCTAACGCTAGATTACGTCAAAATCAACTGTCCCACTGGTCAATGT
TACGGCTGGCTAGCCGTCCATCGGATCAACTTTGCCCTCGGACTCCTCCATCTACTTCTAGCCGGCCTGCTTCTC
GGCGTTAAATCGTCCCGAGGTTCCCGTGCCGCTCTGCAGAATGGGTTTTGGGGCCCCAAGCTCATCATATGGGTG
GTTCTCATCGTCGCCGCCTTCTTGATCCCAGACAGATTCTTCATGTTTTACGGCAATTATGTGTCTCTCGTTTGC
GCGATGCTGTTTCTTCTTCTAGGCCTGATTCTACTGGTTGATCTCGCCCACAACTGGGCTGAATACTGTCTGGCA
CAGATTGAAAGCAGAGACTCGAGGTTGTGGCGCTCTATCCTCATCGGATCAACCCTCGGCATGTATCTGGCATCC
GTCGCCATGACGGTGGTTCAGTTCGTTTTCTTTGCCAAGGGAGATTGTTCCATGAATCAGGCCGTCATCAGCATC
AATCTAGCGCTCTGGGTCACCGTTTCCCTTGTCTCTGTTAATTCGACCGTTCAAGAGCATAACCCACGCGCAGGA
CTCGCTCAGGCGGCCATGGTCGCCGCATATTGCACGTATCTGACCATGTCGGCGGTGTCGATGGAGCCCGACGGC
GACAACCAATGTAATCCTTTAATTCGCGGTCAGGAAACGAGGACAACTTCTGTCATCATCGGCGCTATCGTGACT
ATGCTGACCATAGCATACACAACAACACGCGCCGCTACGCAGAGCCTGGGACTTGGGTCTTCAGATGGTGCCATT
CGACTTCCCGAAGATGCTGACGATCAGCACGACCTTGTCATTCATCAGCCGGCCGCTCGACGCGAGATGCGGGCT
GAGGCATTACGTCGCGCGATCGAGGAAGGCAGTCTTCCGGCTGATGCCGCGCTGTCAGACATGGACAGTGACGCC
ACCGGAGCATCAGAGCATGATGACGAGCGCTCTCGCACTCAGTACAACTATACCATTTTCCACATCATCTTCTTC
CTGGCCACTGCGTGGGTATCTACTTTACTCACACTCAAGTACGAGGAAACGAAGCAAGACGGCGACTTTGCAACT
GTTGGTCGAACGTACGCCGCAAGCTGGGTCAAGATTGTCAGCGCTTGGACATGTTATGGCCTGTACATCTGGACA
TTGACGGCTCCAATTGTATTGCCTGAGAGGTTCGACTTCTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail