Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8453
Gene name
Locationscaffold_942:206..4470
Strand-
Gene length (bp)4264
Transcript length (bp)3453
Coding sequence length (bp)3450
Protein length (aa) 1150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04499 SAPS SIT4 phosphatase-associated protein 5.6E-186 165 825

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74511|EKC1_SCHPO Extragenic suppressor of kinetochore protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ekc1 PE=1 SV=2 1 494 3.0E-100
sp|C8ZCJ2|SA190_YEAS8 SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SAP190 PE=3 SV=1 37 416 2.0E-77
sp|B5VMH6|SA190_YEAS6 SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SAP190 PE=3 SV=1 37 416 2.0E-77
sp|P36123|SA190_YEAST SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP190 PE=1 SV=2 37 416 3.0E-77
sp|P40856|SA185_YEAST SIT4-associating protein SAP185 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP185 PE=1 SV=1 37 417 3.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74511|EKC1_SCHPO Extragenic suppressor of kinetochore protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ekc1 PE=1 SV=2 1 494 3.0E-100
sp|C8ZCJ2|SA190_YEAS8 SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SAP190 PE=3 SV=1 37 416 2.0E-77
sp|B5VMH6|SA190_YEAS6 SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SAP190 PE=3 SV=1 37 416 2.0E-77
sp|P36123|SA190_YEAST SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP190 PE=1 SV=2 37 416 3.0E-77
sp|P40856|SA185_YEAST SIT4-associating protein SAP185 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP185 PE=1 SV=1 37 417 3.0E-77
sp|P43612|SA155_YEAST SIT4-associating protein SAP155 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP155 PE=1 SV=4 115 417 3.0E-61
sp|P53036|SAP4_YEAST SIT4-associating protein SAP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP4 PE=1 SV=1 89 417 2.0E-47
sp|O74511|EKC1_SCHPO Extragenic suppressor of kinetochore protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ekc1 PE=1 SV=2 683 835 1.0E-42
sp|Q8R3Q2|PP6R2_MOUSE Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Mus musculus GN=Ppp6r2 PE=1 SV=1 1 401 3.0E-38
sp|O75170|PP6R2_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens GN=PPP6R2 PE=1 SV=2 1 391 6.0E-35
sp|Q9UPN7|PP6R1_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens GN=PPP6R1 PE=1 SV=5 1 401 1.0E-31
sp|P40856|SA185_YEAST SIT4-associating protein SAP185 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP185 PE=1 SV=1 684 833 5.0E-31
sp|Q6NRI0|P6R3A_XENLA Serine/threonine-protein phosphatase 6 regulatory subunit 3-A OS=Xenopus laevis GN=ppp6r3-a PE=2 SV=1 1 400 2.0E-30
sp|Q6NRF1|P6R3B_XENLA Serine/threonine-protein phosphatase 6 regulatory subunit 3-B OS=Xenopus laevis GN=ppp6r3-b PE=2 SV=1 1 400 2.0E-30
sp|Q5H9R7|PP6R3_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens GN=PPP6R3 PE=1 SV=2 1 402 9.0E-30
sp|Q5F471|PP6R3_CHICK Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Gallus gallus GN=PPP6R3 PE=2 SV=1 1 402 1.0E-29
sp|Q922D4|PP6R3_MOUSE Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Mus musculus GN=Ppp6r3 PE=1 SV=1 1 402 1.0E-29
sp|P36123|SA190_YEAST SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP190 PE=1 SV=2 669 828 2.0E-28
sp|Q7TSI3|PP6R1_MOUSE Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Mus musculus GN=Ppp6r1 PE=1 SV=1 1 384 2.0E-28
sp|B5VMH6|SA190_YEAS6 SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SAP190 PE=3 SV=1 669 828 2.0E-28
sp|C8ZCJ2|SA190_YEAS8 SIT4-associating protein SAP190 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SAP190 PE=3 SV=1 669 828 4.0E-28
sp|P43612|SA155_YEAST SIT4-associating protein SAP155 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP155 PE=1 SV=4 680 829 3.0E-27
sp|P53036|SAP4_YEAST SIT4-associating protein SAP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP4 PE=1 SV=1 684 829 2.0E-24
sp|Q5H9R7|PP6R3_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens GN=PPP6R3 PE=1 SV=2 677 827 5.0E-13
sp|Q922D4|PP6R3_MOUSE Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Mus musculus GN=Ppp6r3 PE=1 SV=1 677 828 9.0E-13
sp|Q5F471|PP6R3_CHICK Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Gallus gallus GN=PPP6R3 PE=2 SV=1 691 825 2.0E-11
sp|Q6NRF1|P6R3B_XENLA Serine/threonine-protein phosphatase 6 regulatory subunit 3-B OS=Xenopus laevis GN=ppp6r3-b PE=2 SV=1 666 831 6.0E-10
sp|Q6NRI0|P6R3A_XENLA Serine/threonine-protein phosphatase 6 regulatory subunit 3-A OS=Xenopus laevis GN=ppp6r3-a PE=2 SV=1 666 831 9.0E-10
sp|Q9UPN7|PP6R1_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens GN=PPP6R1 PE=1 SV=5 666 823 1.0E-08
sp|Q7TSI3|PP6R1_MOUSE Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Mus musculus GN=Ppp6r1 PE=1 SV=1 696 827 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0043666 regulation of phosphoprotein phosphatase activity Yes
GO:0019903 protein phosphatase binding Yes
GO:0008150 biological_process No
GO:0051246 regulation of protein metabolic process No
GO:0050790 regulation of catalytic activity No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0051336 regulation of hydrolase activity No
GO:0031323 regulation of cellular metabolic process No
GO:0005515 protein binding No
GO:0065007 biological regulation No
GO:0035303 regulation of dephosphorylation No
GO:0010921 regulation of phosphatase activity No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065009 regulation of molecular function No
GO:0005488 binding No
GO:0019902 phosphatase binding No
GO:0051174 regulation of phosphorus metabolic process No
GO:0019220 regulation of phosphate metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0031399 regulation of protein modification process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0035304 regulation of protein dephosphorylation No
GO:0019899 enzyme binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8453
MFWRFGGYANISTIDTILDKPDFTLEELLDEGDLIQELKQHNSKLIEYLREDKVLNKLLDYVVAPKLVPVETPQE
SADDDAKGRSRLLPFSRPRASSRADEHDGDENEKRRNRYAHVASEILSSETWSICESLADNRHLIRRFWLFLSRP
APLDPLQASYFTKVNESLFERKTEDMMLLFRSLPNVVPDLLRHVECPMVMDLLLKIIAMDRAEGGQGIVEWLYSR
GMIPRLLSCLDPSHSWVVQTAAGDFIKAIITISANASQNEQQCIGPNELTRQLVSKPCVEKLIGYMLGGGNPLTV
GVGIVIEVIRKNNSDYDPDVGSEASNVPSGRDPIYLGTLLRMFADNVPNFMTLIMNGPTRRQGLASTFGEKLEPL
GFDRFKTCELMAELLHCSNMGLLNEVGSEQLIASRDAQRQRLRAEGKLWPQKEEDQSADDLTMRMPQTNPEEARR
LEITNADDDFEEVEPSREMSEDTSHEFVKAEDDMAAPPPASFLERDDDDFMDEPLTSPQPPFFGVHVQQQPLDDR
DLMVAPLSPSKAKPPRIIETEPEAAAPKDGSREPDKRAADETSGSTPPGATPEPTPEPTTAEIPAESISDLGLKA
ESEALPPGSTECGGLSPHPEDTPPPLFSAPDAGQPGTQQGEAGAPPEPQECHAAAPGHDGSQAEEKLVAAASEKK
DETVTEAVVGDFLKIQFVDHDVVPAILSFFFSYPWNNFLHNVVYDVVQQVFNGPMDRGFNPTLAVSLFEAADITM
AIIKGQHASDVSQAQTKTRMGYMGHLTLIAEEVVKFTERHPPELLSEMVLDKVMSQDWINYVEGALAETRERDNA
ILGGVRPELAIGQRASIGGNGLAGVGLANIGGGAGPASNALAEAGLNGGVEAADSGSNSLGPFAISAGTLMSGFG
SSSDEEDEEGDGDEEDVNSEFRAYTDPLNNTANPLEPPSIPPPPPPPPLNIPPSRARLQLAARLAMHQKNSRATA
AQGGEDGEDPFRDADDDVDAEEAKQQAESGRGSWWRGMIRGTNVDDDDDDDDDDDDDDDDDDDDEEEEFGDFATA
EEAKPAEGTSVLLRPLAVHPAKESIRGLSGLWPFGTKTTKDAAPKSEPDDKAVEVKEATNRTSIDDDDENEEEEE
EEEEEEEDDDDDDGEVVVGGVSSSS
Coding >Ophio5|8453
ATGTTCTGGAGGTTCGGCGGCTACGCCAACATCTCGACCATCGATACCATCCTCGATAAGCCCGACTTTACTCTC
GAAGAGCTGCTTGACGAGGGCGACTTGATTCAGGAGCTCAAGCAGCACAACTCCAAGCTCATCGAGTACTTGCGA
GAGGACAAGGTGCTCAACAAGCTCCTCGACTATGTCGTCGCCCCGAAGCTCGTACCCGTCGAGACACCCCAAGAG
TCGGCCGATGACGACGCCAAGGGTCGAAGCCGTTTGCTGCCCTTTTCCCGTCCCCGCGCCTCCTCCCGCGCCGAT
GAGCACGATGGCGACGAGAACGAGAAGCGCCGCAACCGGTACGCCCACGTCGCTTCCGAGATTCTCTCCTCCGAG
ACGTGGTCCATCTGCGAGTCCCTCGCCGATAACCGCCATCTCATCCGTCGCTTCTGGCTTTTCCTCTCCCGCCCT
GCGCCTCTCGACCCGCTGCAGGCTAGCTATTTCACAAAGGTCAACGAGTCGCTTTTCGAAAGGAAGACCGAGGAC
ATGATGCTCCTGTTTCGGAGCCTGCCCAACGTTGTCCCCGACCTGCTCAGACACGTCGAGTGCCCCATGGTTATG
GATTTGCTTCTCAAAATCATCGCTATGGACCGTGCCGAGGGTGGTCAAGGTATCGTCGAGTGGCTTTATTCCAGA
GGCATGATTCCCAGACTCCTGTCCTGCCTCGACCCGAGCCACAGCTGGGTCGTACAGACGGCCGCCGGCGACTTC
ATCAAGGCCATCATCACCATATCCGCCAACGCCTCTCAGAACGAGCAGCAGTGCATTGGGCCCAACGAGCTGACG
CGCCAACTCGTCTCCAAACCCTGCGTCGAAAAGCTCATTGGCTACATGCTCGGTGGCGGCAACCCGCTTACTGTC
GGCGTCGGCATTGTCATCGAGGTCATCCGTAAGAACAACTCCGACTACGACCCCGATGTCGGCAGCGAGGCCAGC
AACGTTCCGTCTGGCCGCGATCCCATCTACCTGGGCACCTTGCTGCGGATGTTTGCCGACAACGTCCCCAACTTC
ATGACGCTCATCATGAACGGCCCGACGCGCAGGCAGGGCCTCGCCTCGACGTTTGGCGAGAAGCTGGAGCCGCTG
GGCTTCGATCGCTTCAAGACGTGCGAGCTCATGGCCGAGCTGTTGCACTGCAGCAATATGGGTCTGCTCAACGAG
GTCGGCTCCGAGCAGCTTATTGCGTCCCGCGACGCCCAACGGCAGCGCCTGCGAGCTGAGGGCAAGCTGTGGCCG
CAAAAGGAGGAGGACCAGTCGGCCGACGATCTGACCATGCGCATGCCCCAGACGAACCCGGAGGAAGCCCGGCGT
CTCGAGATTACCAACGCCGACGACGACTTCGAGGAGGTGGAACCTAGCCGAGAAATGAGCGAAGACACGTCGCAT
GAGTTTGTCAAGGCCGAGGACGACATGGCTGCGCCGCCGCCCGCCTCATTCCTGGAGAGGGACGACGACGACTTC
ATGGACGAGCCCCTGACCTCTCCTCAACCGCCGTTTTTCGGCGTCCACGTTCAACAGCAGCCCCTCGATGACCGG
GACCTCATGGTGGCGCCCCTGTCGCCTTCGAAAGCCAAGCCGCCCCGAATCATCGAGACAGAGCCGGAAGCCGCT
GCCCCCAAGGACGGCTCCCGAGAGCCGGACAAGCGGGCCGCCGACGAGACGAGCGGATCCACCCCGCCTGGAGCG
ACGCCCGAGCCGACGCCCGAGCCGACGACGGCCGAGATCCCCGCCGAATCCATTTCCGATCTCGGCTTGAAAGCC
GAGTCTGAAGCGCTGCCGCCCGGATCCACCGAGTGCGGCGGTCTATCGCCACACCCCGAGGATACGCCCCCGCCT
CTCTTCTCGGCCCCCGATGCTGGTCAACCCGGGACGCAGCAGGGCGAGGCCGGCGCGCCTCCCGAGCCGCAGGAG
TGCCACGCCGCGGCGCCAGGGCACGACGGGAGCCAAGCAGAGGAGAAGCTGGTGGCGGCAGCCAGTGAGAAAAAG
GATGAGACCGTCACCGAAGCTGTAGTTGGGGACTTTCTCAAGATTCAGTTTGTCGACCATGACGTCGTTCCCGCC
ATTCTGTCCTTCTTCTTCTCCTACCCGTGGAACAACTTCCTCCACAACGTGGTGTACGATGTGGTGCAGCAGGTC
TTCAACGGGCCCATGGATCGGGGCTTCAACCCGACACTGGCCGTGTCCCTGTTTGAGGCGGCCGACATAACCATG
GCCATCATCAAGGGCCAGCACGCCAGCGACGTGTCGCAGGCGCAGACGAAGACGCGCATGGGCTACATGGGCCAC
CTCACCCTCATCGCCGAGGAGGTGGTCAAGTTCACGGAGCGCCACCCGCCGGAGCTATTGTCGGAGATGGTGCTC
GACAAGGTCATGAGCCAAGATTGGATCAACTACGTCGAGGGCGCGCTGGCCGAGACGCGGGAGAGGGACAATGCC
ATCCTCGGCGGCGTGCGGCCGGAACTTGCCATTGGCCAACGAGCGAGCATCGGCGGCAACGGGCTGGCCGGCGTG
GGCCTTGCCAACATCGGGGGCGGCGCGGGGCCGGCTTCCAACGCGCTGGCCGAGGCCGGCCTGAACGGAGGTGTC
GAAGCAGCAGACAGCGGCAGCAACAGCCTCGGCCCCTTTGCCATAAGCGCGGGTACGCTCATGTCGGGCTTCGGC
AGCAGCAGCGACGAGGAGGACGAGGAGGGCGATGGGGATGAGGAAGACGTGAATTCTGAGTTCCGCGCCTACACA
GATCCGCTCAACAACACAGCCAATCCGCTGGAACCACCGTCGATTCCTCCGCCGCCGCCGCCGCCGCCGCTCAAC
ATCCCGCCCTCACGAGCGAGACTGCAGCTGGCAGCCCGGCTGGCGATGCACCAGAAGAACAGTCGGGCAACGGCC
GCGCAAGGCGGCGAGGACGGCGAGGATCCCTTCCGCGACGCCGACGACGACGTCGATGCAGAGGAGGCGAAGCAG
CAGGCCGAATCGGGGCGCGGCTCCTGGTGGAGAGGCATGATACGGGGTACAAACGTCGACGATGACGACGATGAT
GATGATGACGACGACGACGACGACGACGACGACGACGACGATGAAGAAGAGGAGTTTGGAGACTTTGCCACCGCC
GAGGAGGCCAAGCCGGCCGAGGGAACGAGCGTCCTCCTCCGCCCCCTGGCCGTCCACCCAGCCAAGGAATCCATC
AGAGGCCTCAGCGGCCTCTGGCCCTTTGGCACGAAGACGACCAAGGACGCGGCGCCCAAGTCGGAGCCGGACGAC
AAGGCCGTCGAAGTGAAGGAGGCGACGAACCGGACGAGCATCGACGACGACGACGAGAATGAAGAAGAAGAAGAA
GAAGAAGAAGAAGAAGAAGAAGACGACGACGACGACGACGGAGAGGTCGTCGTCGGCGGCGTCTCGTCGTCTTCG
Transcript >Ophio5|8453
ATGTTCTGGAGGTTCGGCGGCTACGCCAACATCTCGACCATCGATACCATCCTCGATAAGCCCGACTTTACTCTC
GAAGAGCTGCTTGACGAGGGCGACTTGATTCAGGAGCTCAAGCAGCACAACTCCAAGCTCATCGAGTACTTGCGA
GAGGACAAGGTGCTCAACAAGCTCCTCGACTATGTCGTCGCCCCGAAGCTCGTACCCGTCGAGACACCCCAAGAG
TCGGCCGATGACGACGCCAAGGGTCGAAGCCGTTTGCTGCCCTTTTCCCGTCCCCGCGCCTCCTCCCGCGCCGAT
GAGCACGATGGCGACGAGAACGAGAAGCGCCGCAACCGGTACGCCCACGTCGCTTCCGAGATTCTCTCCTCCGAG
ACGTGGTCCATCTGCGAGTCCCTCGCCGATAACCGCCATCTCATCCGTCGCTTCTGGCTTTTCCTCTCCCGCCCT
GCGCCTCTCGACCCGCTGCAGGCTAGCTATTTCACAAAGGTCAACGAGTCGCTTTTCGAAAGGAAGACCGAGGAC
ATGATGCTCCTGTTTCGGAGCCTGCCCAACGTTGTCCCCGACCTGCTCAGACACGTCGAGTGCCCCATGGTTATG
GATTTGCTTCTCAAAATCATCGCTATGGACCGTGCCGAGGGTGGTCAAGGTATCGTCGAGTGGCTTTATTCCAGA
GGCATGATTCCCAGACTCCTGTCCTGCCTCGACCCGAGCCACAGCTGGGTCGTACAGACGGCCGCCGGCGACTTC
ATCAAGGCCATCATCACCATATCCGCCAACGCCTCTCAGAACGAGCAGCAGTGCATTGGGCCCAACGAGCTGACG
CGCCAACTCGTCTCCAAACCCTGCGTCGAAAAGCTCATTGGCTACATGCTCGGTGGCGGCAACCCGCTTACTGTC
GGCGTCGGCATTGTCATCGAGGTCATCCGTAAGAACAACTCCGACTACGACCCCGATGTCGGCAGCGAGGCCAGC
AACGTTCCGTCTGGCCGCGATCCCATCTACCTGGGCACCTTGCTGCGGATGTTTGCCGACAACGTCCCCAACTTC
ATGACGCTCATCATGAACGGCCCGACGCGCAGGCAGGGCCTCGCCTCGACGTTTGGCGAGAAGCTGGAGCCGCTG
GGCTTCGATCGCTTCAAGACGTGCGAGCTCATGGCCGAGCTGTTGCACTGCAGCAATATGGGTCTGCTCAACGAG
GTCGGCTCCGAGCAGCTTATTGCGTCCCGCGACGCCCAACGGCAGCGCCTGCGAGCTGAGGGCAAGCTGTGGCCG
CAAAAGGAGGAGGACCAGTCGGCCGACGATCTGACCATGCGCATGCCCCAGACGAACCCGGAGGAAGCCCGGCGT
CTCGAGATTACCAACGCCGACGACGACTTCGAGGAGGTGGAACCTAGCCGAGAAATGAGCGAAGACACGTCGCAT
GAGTTTGTCAAGGCCGAGGACGACATGGCTGCGCCGCCGCCCGCCTCATTCCTGGAGAGGGACGACGACGACTTC
ATGGACGAGCCCCTGACCTCTCCTCAACCGCCGTTTTTCGGCGTCCACGTTCAACAGCAGCCCCTCGATGACCGG
GACCTCATGGTGGCGCCCCTGTCGCCTTCGAAAGCCAAGCCGCCCCGAATCATCGAGACAGAGCCGGAAGCCGCT
GCCCCCAAGGACGGCTCCCGAGAGCCGGACAAGCGGGCCGCCGACGAGACGAGCGGATCCACCCCGCCTGGAGCG
ACGCCCGAGCCGACGCCCGAGCCGACGACGGCCGAGATCCCCGCCGAATCCATTTCCGATCTCGGCTTGAAAGCC
GAGTCTGAAGCGCTGCCGCCCGGATCCACCGAGTGCGGCGGTCTATCGCCACACCCCGAGGATACGCCCCCGCCT
CTCTTCTCGGCCCCCGATGCTGGTCAACCCGGGACGCAGCAGGGCGAGGCCGGCGCGCCTCCCGAGCCGCAGGAG
TGCCACGCCGCGGCGCCAGGGCACGACGGGAGCCAAGCAGAGGAGAAGCTGGTGGCGGCAGCCAGTGAGAAAAAG
GATGAGACCGTCACCGAAGCTGTAGTTGGGGACTTTCTCAAGATTCAGTTTGTCGACCATGACGTCGTTCCCGCC
ATTCTGTCCTTCTTCTTCTCCTACCCGTGGAACAACTTCCTCCACAACGTGGTGTACGATGTGGTGCAGCAGGTC
TTCAACGGGCCCATGGATCGGGGCTTCAACCCGACACTGGCCGTGTCCCTGTTTGAGGCGGCCGACATAACCATG
GCCATCATCAAGGGCCAGCACGCCAGCGACGTGTCGCAGGCGCAGACGAAGACGCGCATGGGCTACATGGGCCAC
CTCACCCTCATCGCCGAGGAGGTGGTCAAGTTCACGGAGCGCCACCCGCCGGAGCTATTGTCGGAGATGGTGCTC
GACAAGGTCATGAGCCAAGATTGGATCAACTACGTCGAGGGCGCGCTGGCCGAGACGCGGGAGAGGGACAATGCC
ATCCTCGGCGGCGTGCGGCCGGAACTTGCCATTGGCCAACGAGCGAGCATCGGCGGCAACGGGCTGGCCGGCGTG
GGCCTTGCCAACATCGGGGGCGGCGCGGGGCCGGCTTCCAACGCGCTGGCCGAGGCCGGCCTGAACGGAGGTGTC
GAAGCAGCAGACAGCGGCAGCAACAGCCTCGGCCCCTTTGCCATAAGCGCGGGTACGCTCATGTCGGGCTTCGGC
AGCAGCAGCGACGAGGAGGACGAGGAGGGCGATGGGGATGAGGAAGACGTGAATTCTGAGTTCCGCGCCTACACA
GATCCGCTCAACAACACAGCCAATCCGCTGGAACCACCGTCGATTCCTCCGCCGCCGCCGCCGCCGCCGCTCAAC
ATCCCGCCCTCACGAGCGAGACTGCAGCTGGCAGCCCGGCTGGCGATGCACCAGAAGAACAGTCGGGCAACGGCC
GCGCAAGGCGGCGAGGACGGCGAGGATCCCTTCCGCGACGCCGACGACGACGTCGATGCAGAGGAGGCGAAGCAG
CAGGCCGAATCGGGGCGCGGCTCCTGGTGGAGAGGCATGATACGGGGTACAAACGTCGACGATGACGACGATGAT
GATGATGACGACGACGACGACGACGACGACGACGACGACGATGAAGAAGAGGAGTTTGGAGACTTTGCCACCGCC
GAGGAGGCCAAGCCGGCCGAGGGAACGAGCGTCCTCCTCCGCCCCCTGGCCGTCCACCCAGCCAAGGAATCCATC
AGAGGCCTCAGCGGCCTCTGGCCCTTTGGCACGAAGACGACCAAGGACGCGGCGCCCAAGTCGGAGCCGGACGAC
AAGGCCGTCGAAGTGAAGGAGGCGACGAACCGGACGAGCATCGACGACGACGACGAGAATGAAGAAGAAGAAGAA
GAAGAAGAAGAAGAAGAAGAAGACGACGACGACGACGACGGAGAGGTCGTCGTCGGCGGCGTCTCGTCGTCTTCG
TAA
Gene >Ophio5|8453
ATGTTCTGGAGGTTCGGCGGCTACGCCAACATCTCGACCATCGATACCATCCTCGATAAGCCCGACTTTACTCTC
GAAGAGCTGCTTGACGAGGGCGACTTGATTCAGGAGCTCAAGCAGCACAACTCCAAGCTCATCGAGTACTTGCGA
GAGGACAAGGTGCTCAACAAGCTCCTCGACTATGTCGTCGCCCCGAAGCTCGTACCCGTCGAGACACCCCAAGAG
TCGGCCGATGACGACGCCAAGGGTCGAAGCCGTTTGCTGCCCTTTTCCCGTCCCCGCGCCTCCTCCCGCGCCGAT
GAGCACGATGGCGACGAGAACGAGAAGCGCCGCAACCGGTACGCCCACGTCGCTTCCGAGATTCTCTCCTCCGAG
ACGTGGTCCATCTGCGAGTCCCTCGCCGATAACCGCCATCTCATCCGTCGCTTCTGGCTTTTCCTCTCCCGCCCT
GCGCCTCTCGACCCGCTGCAGGCTAGCTATTTCACAAAGGTCAACGAGTCGCTTTTCGAAAGGAAGACCGAGGAC
ATGATGCTCCTGTTTCGGAGCCTGCCCAACGTTGTCCCCGACCTGCTCAGACACGTCGAGTGCCCCATGGTTATG
GATTTGCTTCTCAAAATCATCGCTATGGACCGTGCCGAGGGTGGTCAAGGTATCGTCGAGGTATTAGTCCCCCCC
AACATATATCCGCCCGTACACCTCTCTAACCTTGCACCTCCCCTCCCCAGTGGCTTTATTCCAGAGGCATGATTC
CCAGACTCCTGTCCTGCCTCGACCCGAGCCACAGCTGGGTCGTACAGACGGCCGCCGGCGACTTCATCAAGGCCA
TCATCACCATATCCGCCAACGCCTCTCAGAACGAGCAGCAGTGCATTGGGCCCAACGAGCTGACGCGCCAACTCG
TCTCCAAACCCTGCGTCGAAAAGCTCATTGGCTACATGCTCGGTGGCGGCAACCCGCTTACTGTCGGCGTCGGCA
TTGTCATCGAGGTCATCCGTAAGAACAACTCCGACTACGACCCCGATGTCGGCAGCGAGGCCAGCAACGTTCCGT
CTGGCCGCGATCCCATCTACCTGGGCACCTTGCTGCGGATGTTTGCCGACAACGTCCCCAACTTCATGACGCTCA
TCATGAACGGCCCGACGCGCAGGCAGGGCCTCGCCTCGACGTTTGGCGAGAAGCTGGAGCCGCTGGGCTTCGATC
GCTTCAAGACGTGCGAGCTCATGGCCGAGCTGTTGCACTGCAGCAATATGGGTCTGCTCAACGAGGTCGGCTCCG
AGCAGCTTATTGCGTCCCGCGACGCCCAACGGCAGCGCCTGCGAGCTGAGGGCAAGCTGTGGCCGCAAAAGGAGG
AGGACCAGTCGGCCGACGATCTGACCATGCGCATGCCCCAGACGAACCCGGAGGAAGCCCGGCGTCTCGAGATTA
CCAACGCCGACGACGACTTCGAGGAGGTGGAACCTAGCCGAGAAATGAGCGAAGACACGTCGCATGAGTTTGTCA
AGGCCGAGGACGACATGGCTGCGCCGCCGCCCGCCTCATTCCTGGAGAGGGACGACGACGACTTCATGGACGAGC
CCCTGACCTCTCCTCAACCGCCGTTTTTCGGCGTCCACGTTCAACAGCAGCCCCTCGATGACCGGGACCTCATGG
TGGCGCCCCTGTCGCCTTCGAAAGCCAAGCCGCCCCGAATCATCGAGACAGAGCCGGAAGCCGCTGCCCCCAAGG
ACGGCTCCCGAGAGCCGGACAAGCGGGCCGCCGACGAGACGAGCGGATCCACCCCGCCTGGAGCGACGCCCGAGC
CGACGCCCGAGCCGACGACGGCCGAGATCCCCGCCGAATCCATTTCCGATCTCGGCTTGAAAGCCGAGTCTGAAG
CGCTGCCGCCCGGATCCACCGAGTGCGGCGGTCTATCGCCACACCCCGAGGATACGCCCCCGCCTCTCTTCTCGG
CCCCCGATGCTGGTCAACCCGGGACGCAGCAGGGCGAGGCCGGCGCGCCTCCCGAGCCGCAGGAGTGCCACGCCG
CGGCGCCAGGGCACGACGGGAGCCAAGCAGAGGAGAAGCTGGTGGCGGCAGCCAGTGAGAAAAAGGATGAGACCG
TCACCGAAGCTGTAGTTGGGGACTTTCTCAAGATTCAGTTTGTCGACCATGACGTCGTTCCCGCCATTCTGGTAA
GAGGCCTCGTCTCGGGCACGAATCCCGGCTGACGAACGCAGTCCTTCTTCTTCTCCTACCCGTGGAACAACTTCC
TCCACAACGTGGTGTACGATGTGGTGCAGCAGGTCTTCAACGGGCCCATGGATCGGGGCTTCAACCCGACACTGG
CCGTGTCCCTGTTTGAGGCGGCCGACATAACCATGGCCATCATCAAGGGCCAGCACGCCAGCGACGTGTCGCAGG
CGCAGACGAAGACGCGCATGGGCTACATGGGCCACCTCACCCTCATCGCCGAGGAGGTGGTCAAGTTCACGGAGC
GCCACCCGCCGGAGCTATTGTCGGAGATGGTGCTCGACAAGGTCATGAGCCAAGATTGGATCAACTACGTCGAGG
GCGCGCTGGCCGAGACGCGGGAGAGGGACAATGCCATCCTCGGCGGCGTGCGGCCGGAACTTGCCATTGGCCAAC
GAGCGAGCATCGGCGGCAACGGGCTGGCCGGCGTGGGCCTTGCCAACATCGGGGGCGGCGCGGGGCCGGCTTCCA
ACGCGCTGGCCGAGGCCGGCCTGAACGGAGGTGTCGAAGCAGCAGACAGCGGCAGCAACAGCCTCGGCCCCTTTG
CCATAAGCGCGGGTACGCTCATGTCGGGCTTCGGCAGCAGCAGCGACGAGGAGGACGAGGAGGGCGATGGGGATG
AGGAAGACGTGAATTCTGAGGTGAGTGGTGATTCATATGAAGAGCGCAGCGGCACCGCTGCCGAAGCGACCGACG
AGGACGTCGTCATGACGTCGTCTCCCGGTACCGGCGCGGCCCGAACTGCCAAGTTGCACGGCCAACGCCCAGTCG
AGGAGGACGATCCAATGCTTCCGTAGGACGGGACATTGGGAAGAGGGCTCGATGGCCAGGCAAGCGCCACTCCTG
ATTGTCCCATGGCCTGCATTCGGCTATACGGGATGGCGGCGCGCGGGCGTGTTGAGGGCGAGGCGAGAGGACGTC
GACGAGCGGCAAGACGTCGTCGATCCGCCTCTGATGGCGACGCTCTGTATAATGTATCGAAAAGGGCATGGTGGA
AAGGGGCCGTCGCAGATTGCTGTTTCTCCTCTCTTCTCGTCCGCTTCCCGGCCATTCGCCATTCTTGTCCTATTC
ATCCTCCTTCTGCCGTCCCTCCCCCCTTTCTCCTGTCCATTCACAACGACAATGCGGGACATCAGCTAGGGGGAT
GGCATAGGCAAGGAGATAGGACAGTGCAAGAGGAAGGGGCCAAGCCGCGACTGGGCATTGGAGACAAGACGTCGG
CTGGCGGAGACAGGAGATGTCTCTGTCTACCGCGACGAGCGCCTCATTTCCTTTCGTCATACTTGCCCGGCTCGG
GCTCCCAGACGGGAAGATACTGATACGGCTACCCGTCTCGATCTAGTTCCGCGCCTACACAGATCCGCTCAACAA
CACAGCCAATCCGCTGGAACCACCGTCGATTCCTCCGCCGCCGCCGCCGCCGCCGCTCAACATCCCGCCCTCACG
AGCGAGACTGCAGCTGGCAGCCCGGCTGGCGATGCACCAGAAGAACAGTCGGGCAACGGCCGCGCAAGGCGGCGA
GGACGGCGAGGATCCCTTCCGCGACGCCGACGACGACGTCGATGCAGAGGAGGCGAAGCAGCAGGCCGAATCGGG
GCGCGGCTCCTGGTGGAGAGGCATGATACGGGGTACAAACGTCGACGATGACGACGATGATGATGATGACGACGA
CGACGACGACGACGACGACGACGACGATGAAGAAGAGGAGTTTGGAGACTTTGCCACCGCCGAGGAGGCCAAGCC
GGCCGAGGGAACGAGCGTCCTCCTCCGCCCCCTGGCCGTCCACCCAGCCAAGGAATCCATCAGAGGCCTCAGCGG
CCTCTGGCCCTTTGGCACGAAGACGACCAAGGACGCGGCGCCCAAGTCGGAGCCGGACGACAAGGCCGTCGAAGT
GAAGGAGGCGACGAACCGGACGAGCATCGACGACGACGACGAGAATGAAGAAGAAGAAGAAGAAGAAGAAGAAGA
AGAAGAAGACGACGACGACGACGACGGAGAGGTCGTCGTCGGCGGCGTCTCGTCGTCTTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail