Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8451
Gene name
Locationscaffold_940:2081..4592
Strand-
Gene length (bp)2511
Transcript length (bp)1851
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.2E-116 1 606

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53134|YGL4_YEAST Putative oligopeptide transporter YGL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL114W PE=1 SV=1 2 610 7.0E-144
sp|Q6R3K9|YSL2_ARATH Metal-nicotianamine transporter YSL2 OS=Arabidopsis thaliana GN=YSL2 PE=1 SV=1 183 604 1.0E-24
sp|Q9LUN2|YSL5_ARATH Probable metal-nicotianamine transporter YSL5 OS=Arabidopsis thaliana GN=YSL5 PE=1 SV=1 181 607 4.0E-23
sp|Q6H3Z6|YSL2_ORYSJ Metal-nicotianamine transporter YSL2 OS=Oryza sativa subsp. japonica GN=YSL2 PE=2 SV=2 202 604 7.0E-23
sp|Q6H7J6|YSL14_ORYSJ Probable metal-nicotianamine transporter YSL14 OS=Oryza sativa subsp. japonica GN=YSL14 PE=2 SV=1 181 604 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53134|YGL4_YEAST Putative oligopeptide transporter YGL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL114W PE=1 SV=1 2 610 7.0E-144
sp|Q6R3K9|YSL2_ARATH Metal-nicotianamine transporter YSL2 OS=Arabidopsis thaliana GN=YSL2 PE=1 SV=1 183 604 1.0E-24
sp|Q9LUN2|YSL5_ARATH Probable metal-nicotianamine transporter YSL5 OS=Arabidopsis thaliana GN=YSL5 PE=1 SV=1 181 607 4.0E-23
sp|Q6H3Z6|YSL2_ORYSJ Metal-nicotianamine transporter YSL2 OS=Oryza sativa subsp. japonica GN=YSL2 PE=2 SV=2 202 604 7.0E-23
sp|Q6H7J6|YSL14_ORYSJ Probable metal-nicotianamine transporter YSL14 OS=Oryza sativa subsp. japonica GN=YSL14 PE=2 SV=1 181 604 5.0E-22
sp|Q9SHY2|YSL7_ARATH Probable metal-nicotianamine transporter YSL7 OS=Arabidopsis thaliana GN=YSL7 PE=2 SV=1 183 604 6.0E-22
sp|Q7XN54|YSL16_ORYSJ Probable metal-nicotianamine transporter YSL16 OS=Oryza sativa subsp. japonica GN=YSL16 PE=2 SV=2 202 604 1.0E-21
sp|Q6H3Z3|YSL15_ORYSJ Iron-phytosiderophore transporter YSL15 OS=Oryza sativa subsp. japonica GN=YSL15 PE=2 SV=1 202 604 1.0E-21
sp|Q6R3L0|YSL1_ARATH Metal-nicotianamine transporter YSL1 OS=Arabidopsis thaliana GN=YSL1 PE=2 SV=2 202 604 1.0E-20
sp|Q7XRV2|YSL6_ORYSJ Probable metal-nicotianamine transporter YSL6 OS=Oryza sativa subsp. japonica GN=YSL6 PE=2 SV=1 183 607 1.0E-20
sp|Q6R3K4|YSL8_ARATH Probable metal-nicotianamine transporter YSL8 OS=Arabidopsis thaliana GN=YSL8 PE=1 SV=2 192 604 3.0E-20
sp|Q5JQD7|YSL12_ORYSJ Probable metal-nicotianamine transporter YSL12 OS=Oryza sativa subsp. japonica GN=YSL12 PE=2 SV=2 181 604 6.0E-20
sp|Q6AVD0|YSL3_ORYSJ Probable metal-nicotianamine transporter YSL3 OS=Oryza sativa subsp. japonica GN=YSL3 PE=2 SV=2 181 607 4.0E-19
sp|Q941V3|YSL18_ORYSJ Probable metal-nicotianamine transporter YSL18 OS=Oryza sativa subsp. japonica GN=YSL18 PE=2 SV=1 183 607 6.0E-19
sp|Q2EF88|YSL3_ARATH Metal-nicotianamine transporter YSL3 OS=Arabidopsis thaliana GN=YSL3 PE=2 SV=1 183 604 3.0E-18
sp|Q7XKF4|YSL13_ORYSJ Probable metal-nicotianamine transporter YSL13 OS=Oryza sativa subsp. japonica GN=YSL13 PE=2 SV=2 181 604 6.0E-18
sp|Q7XRV1|YSL5_ORYSJ Probable metal-nicotianamine transporter YSL5 OS=Oryza sativa subsp. japonica GN=YSL5 PE=2 SV=3 183 607 7.0E-18
sp|Q6R3K6|YSL6_ARATH Probable metal-nicotianamine transporter YSL6 OS=Arabidopsis thaliana GN=YSL6 PE=2 SV=2 181 604 1.0E-17
sp|Q7XUJ2|YSL9_ORYSJ Probable metal-nicotianamine transporter YSL9 OS=Oryza sativa subsp. japonica GN=YSL9 PE=2 SV=2 202 604 1.0E-17
sp|Q6ZGM7|YSL7_ORYSJ Probable metal-nicotianamine transporter YSL7 OS=Oryza sativa subsp. japonica GN=YSL7 PE=2 SV=1 160 604 6.0E-17
sp|Q0J932|YSL10_ORYSJ Probable metal-nicotianamine transporter YSL10 OS=Oryza sativa subsp. japonica GN=YSL10 PE=2 SV=2 183 604 5.0E-16
sp|Q7X660|YSL11_ORYSJ Probable metal-nicotianamine transporter YSL11 OS=Oryza sativa subsp. japonica GN=YSL11 PE=2 SV=1 181 604 3.0E-15
sp|Q0E4J6|YSL8_ORYSJ Probable metal-nicotianamine transporter YSL8 OS=Oryza sativa subsp. japonica GN=YSL8 PE=2 SV=1 156 607 1.0E-14
sp|Q9AY27|YS1_MAIZE Iron-phytosiderophore transporter yellow stripe 1 OS=Zea mays GN=YS1 PE=2 SV=1 202 604 2.0E-14
sp|Q688S6|YSL4_ORYSJ Probable metal-nicotianamine transporter YSL4 OS=Oryza sativa subsp. japonica GN=YSL4 PE=2 SV=1 197 607 2.0E-12
sp|Q6ZCX1|YSL17_ORYSJ Probable metal-nicotianamine transporter YSL17 OS=Oryza sativa subsp. japonica GN=YSL17 PE=2 SV=1 396 604 5.0E-12
sp|Q6R3K8|YSL4_ARATH Probable metal-nicotianamine transporter YSL4 OS=Arabidopsis thaliana GN=YSL4 PE=2 SV=1 181 604 5.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 33 51 18
2 160 182 22
3 192 214 22
4 221 240 19
5 255 277 22
6 347 369 22
7 374 396 22
8 426 445 19
9 465 482 17
10 489 511 22
11 521 543 22
12 550 569 19
13 589 611 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 45.11 24.79 65.44
CcL In ants, during behavior modification 90.42 47.92 132.92
CcD In ants, recently dead 52.22 28.52 75.92

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000997 yes
SC16a CcD 0.549609 no
CcL CcD 0.013135 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8451
MPLGCGFVGVIPAMNYLLTPNEWGPLSLRLDQLVVWSLGLCYFGVVFAVPLRHQVIVRERLRFPSGFSTAVLITV
LHGHWRPSADKEALDAAARGGYASLVPRNDSPNPPSAEVRSAEPSASGQEPEPEPEPEPELESESESEPDAQSFD
PSDWAYNMRLLMVSFCMSGAFTICTYFFPVLRNIPILGTGAASSWLWTLNPSLAYVGQGIIMGVETTMHMTFGAI
IGWGILSPLAKFRGWAPGPVDDWQHGSKGWIVWISLAIMLVDAVISLCFVALRSVVGIRFTSLLGCTMLRLRGSW
NSFGRRAAYHPLPSDEQQRQDPAHIVQSTCGQDEQLKDAPADQRIDVRLVVAGLLASIFLCIGTVHAVFGNLVPI
YATIVAVLMALVLSIMGVRALGETDLNPVSGISKLAQLFFAIIVPQTSKSSVLINLVAGAISEAGALQAGDLMQD
LKTGHLLGASPKAQFWGQMIGATVGAILSALLYRLYTKVYTIPGELFQVPTAYVWIFTARLVTGQGLPPMASQWA
TGAGAFFTLTTMARIASVGRAWRSWVPGGIAVAVGMYNVPSFTLGRAAGGLIGWFWTRIMQRSGTPLIIIASGFI
LGEGCFSPLHFRKSQD
Coding >Ophio5|8451
ATGCCTCTCGGCTGCGGGTTCGTCGGAGTCATTCCGGCTATGAATTACCTATTAACACCTAACGAATGGGGCCCT
CTATCTTTGCGTCTTGATCAACTGGTCGTCTGGTCCCTCGGCCTCTGCTATTTCGGTGTCGTATTTGCCGTACCT
TTGCGCCACCAGGTGATTGTACGGGAGCGTCTGAGGTTCCCAAGTGGCTTCAGCACAGCGGTTCTTATTACCGTC
TTGCATGGTCACTGGCGGCCCTCCGCCGACAAGGAAGCCCTTGATGCGGCTGCCCGGGGAGGATATGCCAGCCTG
GTGCCTCGCAATGACTCCCCCAATCCACCCTCCGCGGAGGTAAGAAGTGCCGAACCTAGTGCTTCGGGCCAGGAG
CCGGAGCCGGAGCCGGAGCCGGAGCCGGAGTTGGAGTCGGAGTCGGAGTCGGAGCCGGATGCGCAGTCATTTGAT
CCTTCTGACTGGGCATACAACATGCGGCTCTTGATGGTGTCGTTCTGCATGTCCGGCGCATTCACAATTTGCACT
TATTTCTTCCCAGTCCTGAGGAACATCCCTATCCTGGGTACTGGCGCGGCTAGCAGCTGGCTCTGGACTTTGAAC
CCAAGCCTGGCATATGTCGGGCAAGGTATAATAATGGGTGTCGAAACGACAATGCACATGACATTTGGTGCAATC
ATCGGTTGGGGTATTCTTAGCCCCTTGGCGAAATTCAGGGGCTGGGCTCCTGGCCCAGTCGATGACTGGCAACAC
GGAAGCAAGGGCTGGATTGTCTGGATTTCGCTCGCCATTATGCTCGTCGATGCCGTGATTAGTCTTTGCTTTGTT
GCTTTGCGTTCCGTTGTGGGCATCCGGTTTACCAGCTTGCTTGGGTGTACGATGCTGCGGCTCCGTGGCTCATGG
AACTCATTTGGGCGTCGCGCTGCATACCACCCTCTGCCGAGCGACGAGCAACAACGCCAAGACCCAGCTCACATT
GTTCAGAGCACTTGCGGCCAAGATGAGCAGCTCAAAGATGCGCCTGCAGATCAGCGTATCGATGTCCGCTTGGTG
GTTGCCGGGCTACTTGCGTCCATCTTCCTATGCATCGGGACGGTGCACGCCGTGTTTGGAAATCTCGTCCCCATC
TATGCGACCATCGTCGCCGTCCTCATGGCACTTGTTCTCAGCATCATGGGCGTCAGAGCTCTCGGTGAAACGGAC
CTAAATCCTGTTTCTGGAATCAGCAAATTGGCCCAGCTGTTCTTTGCCATCATCGTTCCACAGACCAGCAAATCA
AGCGTCCTCATCAATCTAGTCGCTGGTGCCATTTCCGAAGCCGGCGCATTGCAGGCTGGTGATCTGATGCAGGAT
CTGAAGACTGGCCACCTTCTCGGCGCTTCGCCAAAAGCGCAGTTCTGGGGTCAGATGATTGGTGCTACTGTCGGT
GCCATTCTGAGTGCACTTCTATATCGCCTTTATACCAAGGTTTACACGATCCCCGGTGAGCTCTTTCAGGTCCCT
ACTGCGTATGTGTGGATCTTCACCGCCAGACTTGTGACGGGGCAGGGTCTGCCACCGATGGCGAGCCAGTGGGCA
ACAGGCGCAGGTGCCTTCTTCACTCTTACGACAATGGCTAGGATTGCTTCAGTTGGGAGAGCTTGGCGATCGTGG
GTTCCAGGAGGGATTGCTGTCGCCGTCGGCATGTACAACGTTCCGTCCTTCACCTTGGGCAGAGCCGCAGGGGGA
TTGATTGGCTGGTTTTGGACTCGAATCATGCAACGATCTGGTACCCCCCTGATCATCATAGCTTCTGGCTTTATC
CTCGGCGAGGGTTGCTTCTCTCCCTTGCATTTCAGAAAATCCCAAGAT
Transcript >Ophio5|8451
ATGCCTCTCGGCTGCGGGTTCGTCGGAGTCATTCCGGCTATGAATTACCTATTAACACCTAACGAATGGGGCCCT
CTATCTTTGCGTCTTGATCAACTGGTCGTCTGGTCCCTCGGCCTCTGCTATTTCGGTGTCGTATTTGCCGTACCT
TTGCGCCACCAGGTGATTGTACGGGAGCGTCTGAGGTTCCCAAGTGGCTTCAGCACAGCGGTTCTTATTACCGTC
TTGCATGGTCACTGGCGGCCCTCCGCCGACAAGGAAGCCCTTGATGCGGCTGCCCGGGGAGGATATGCCAGCCTG
GTGCCTCGCAATGACTCCCCCAATCCACCCTCCGCGGAGGTAAGAAGTGCCGAACCTAGTGCTTCGGGCCAGGAG
CCGGAGCCGGAGCCGGAGCCGGAGCCGGAGTTGGAGTCGGAGTCGGAGTCGGAGCCGGATGCGCAGTCATTTGAT
CCTTCTGACTGGGCATACAACATGCGGCTCTTGATGGTGTCGTTCTGCATGTCCGGCGCATTCACAATTTGCACT
TATTTCTTCCCAGTCCTGAGGAACATCCCTATCCTGGGTACTGGCGCGGCTAGCAGCTGGCTCTGGACTTTGAAC
CCAAGCCTGGCATATGTCGGGCAAGGTATAATAATGGGTGTCGAAACGACAATGCACATGACATTTGGTGCAATC
ATCGGTTGGGGTATTCTTAGCCCCTTGGCGAAATTCAGGGGCTGGGCTCCTGGCCCAGTCGATGACTGGCAACAC
GGAAGCAAGGGCTGGATTGTCTGGATTTCGCTCGCCATTATGCTCGTCGATGCCGTGATTAGTCTTTGCTTTGTT
GCTTTGCGTTCCGTTGTGGGCATCCGGTTTACCAGCTTGCTTGGGTGTACGATGCTGCGGCTCCGTGGCTCATGG
AACTCATTTGGGCGTCGCGCTGCATACCACCCTCTGCCGAGCGACGAGCAACAACGCCAAGACCCAGCTCACATT
GTTCAGAGCACTTGCGGCCAAGATGAGCAGCTCAAAGATGCGCCTGCAGATCAGCGTATCGATGTCCGCTTGGTG
GTTGCCGGGCTACTTGCGTCCATCTTCCTATGCATCGGGACGGTGCACGCCGTGTTTGGAAATCTCGTCCCCATC
TATGCGACCATCGTCGCCGTCCTCATGGCACTTGTTCTCAGCATCATGGGCGTCAGAGCTCTCGGTGAAACGGAC
CTAAATCCTGTTTCTGGAATCAGCAAATTGGCCCAGCTGTTCTTTGCCATCATCGTTCCACAGACCAGCAAATCA
AGCGTCCTCATCAATCTAGTCGCTGGTGCCATTTCCGAAGCCGGCGCATTGCAGGCTGGTGATCTGATGCAGGAT
CTGAAGACTGGCCACCTTCTCGGCGCTTCGCCAAAAGCGCAGTTCTGGGGTCAGATGATTGGTGCTACTGTCGGT
GCCATTCTGAGTGCACTTCTATATCGCCTTTATACCAAGGTTTACACGATCCCCGGTGAGCTCTTTCAGGTCCCT
ACTGCGTATGTGTGGATCTTCACCGCCAGACTTGTGACGGGGCAGGGTCTGCCACCGATGGCGAGCCAGTGGGCA
ACAGGCGCAGGTGCCTTCTTCACTCTTACGACAATGGCTAGGATTGCTTCAGTTGGGAGAGCTTGGCGATCGTGG
GTTCCAGGAGGGATTGCTGTCGCCGTCGGCATGTACAACGTTCCGTCCTTCACCTTGGGCAGAGCCGCAGGGGGA
TTGATTGGCTGGTTTTGGACTCGAATCATGCAACGATCTGGTACCCCCCTGATCATCATAGCTTCTGGCTTTATC
CTCGGCGAGGGTTGCTTCTCTCCCTTGCATTTCAGAAAATCCCAAGATTGA
Gene >Ophio5|8451
ATGCCTCTCGGCTGCGGGTTCGTCGGAGTCGTCAGTACAGCCTGTTTCAGCGCGCCTGCCCTGCCGTAGCACATC
CTCACCAATCTTTCACAGATTCCGGCTATGAATTACCTATTAACACCTAACGAATGGGGCCCTCTATCTTTGCGT
CTTGATCAACTGGTCGTCTGGTCCCTCGGCCTCTGCTATTTCGGTGTCGTATTTGCCGTACCTTTGTGAGAACTT
CCTCGCCTGTACACACCTACATGTTCGAAGTCCTAGCTTCACTTCGTCCGAGTGTTTTGGCTGATGGAAGACCCT
GTTACTGTTTTGGCACAGGCGCCACCAGGTGATTGTACGGGAGCGTCTGAGGTTCCCAAGTGGCTTCAGCACAGC
GGTTCTTATTACCGTCTTGCATGGTCACTGGCGGCCCTCCGCCGACAAGGAAGCCCTTGATGCGGCTGCCCGGGG
AGGATATGCCAGCCTGGTGCCTCGCAATGACTCCCCCAATCCACCCTCCGCGGAGGTAAGAAGTGCCGAACCTAG
TGCTTCGGGCCAGGAGCCGGAGCCGGAGCCGGAGCCGGAGCCGGAGTTGGAGTCGGAGTCGGAGTCGGAGCCGGA
TGCGCAGTCATTTGATCCTTCTGACTGGGCATACAACATGCGGCTCTTGATGGTGTCGTTCTGCATGTCCGGCGC
ATTCACAATTTGCACTTATTTCTTCCCAGTCCTGAGGAACATCCCTATCCTGGGTACTGGCGCGGCTAGCAGCTG
GCTCTGGACTTTGAACCCAAGCCTGGCATATGTCGGGCAAGGTATAATAATGGGTGTCGAAACGACAATGCACAT
GACATTTGGTGCAATCATCGGTTGGGGTATTCTTAGCCCCTTGGCGAAATTCAGGGGCTGGGCTCCTGGCCCAGT
CGATGACTGGCAACACGGAAGCAAGGGCTGGATTGTCTGGATTTCGCTCGCCATTATGCTCGTCGATGCCGTGAT
TAGTCTTTGCTTTGTTGCTTTGCGTTCCGTTGTGGGCATCCGGTTTACCAGCTTGCTTGGGTGTACGATGCTGCG
GCTCCGTGGCTCATGGAACTCATTTGGGCGTCGCGCTGCATACCACCCTCTGCCGAGCGACGAGCAACAACGCCA
AGACCCAGCTCACATTGTTCAGAGCACTTGCGGCCAAGATGAGCAGCTCAAAGATGCGCCTGCAGATCAGCGTAT
CGATGTCCGCTTGGTGGTTGCCGGGCTACTTGCGTCCATCTTCCTATGCATCGGGACGGTGCACGCCGTGTTTGG
AAATCTCGTCCCCATCTATGCGACCATCGTCGCCGTCCTCATGGCACTTGTTCTCAGCATCATGGGCGTCAGAGC
TCTCGGTGAAACGGACCTAAATCCTGTTTCTGGAATCAGCAAATTGGCCCAGCTGTTCTTTGCCATCATCGTTCC
ACAGACCAGCAAATCAAGCGTCCTCATCAATCTAGTCGCTGGTGCCATTGTACGTACCCTCTCCGCTTCAAAGCC
CTTCAGCTTAGACTCGTCGCGTGGATTCTTCATCGAATGGCATTTCCCTCTGTCGTCCTTCGAACGCGAATCGTG
CCACTGACCGATAATCTGCAGTCCGAAGCCGTGAGTCTTTTGTCGCGATGACACGGCGTACCTGAGTGGCGATGC
TCACGCTGAAGATATAGGGCGCATTGCAGGCTGGTGATCTGATGCAGGATCTGAAGACTGGCCACCTTCTCGGCG
CTTCGCCAAAAGCGCAGTTCTGGGGTCAGATGATTGGTGCTACTGTCGGTGCCATTCTGAGTGCACTTCTATATC
GCCTTTATACCAAGTTGGTCAAATATCTATCCCCCGCTTCGTGTGTATATTTAGAAGCCTTGTTAACAGCAGACC
AAATCCAGGGTTTACACGATCCCCGGTGAGCTCTTTCAGGTCCCTACTGCGTATGTGTGGATCTTCACCGCCAGA
CTTGTGACGGGGCAGGGTCTGCCACCGATGGCGAGCCAGTGGGCAACAGGCGCAGGTGCCTTCTTCACTCTTACG
ACAATGGCTAGGATTGCTTCAGTTGGGAGAGCTTGGCGATCGTGGGTTCCAGGAGGGATTGCTGTCGCCGTCGGT
AAGCCAAATATCCGGAGGGATTGCTGCTAGGCTTCGCTGAGAGACAACCGCAGGCATGTACAACGTTCCGTCCTT
CACCTTGGGCAGAGCCGCAGGGGGATTGATTGGCTGGTTTTGGACTCGAATCATGCAACGATCTGGTACCCCCCT
GATCATCATAGCTTCTGTGAGGCTGCATGCATAAAACTGAAAGATCGAGATGCCGAAGCTGACCTATCTCAAGGG
CTTTATCCTCGGCGAGGGGTTCCTCAGCATTTTCAATTTGATCTTACAGAGCTTCAGCGTGCCGCATTTCTGAAT
TAAAGTTGCTTCTCTCCCTTGCATTTCAGAAAGTATGGACCAAACTCCGTCTAACCGTCAACCACTGCGCTAAGA
CTCTGCGTCTGCCTTCACTTCAGATCCCAAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail