Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8451
Gene name
Locationscaffold_940:2081..4592
Strand-
Gene length (bp)2511
Transcript length (bp)1851
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.2E-116 1 606

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53134|YGL4_YEAST Putative oligopeptide transporter YGL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL114W PE=1 SV=1 2 610 7.0E-144
sp|Q6R3K9|YSL2_ARATH Metal-nicotianamine transporter YSL2 OS=Arabidopsis thaliana GN=YSL2 PE=1 SV=1 183 604 1.0E-24
sp|Q9LUN2|YSL5_ARATH Probable metal-nicotianamine transporter YSL5 OS=Arabidopsis thaliana GN=YSL5 PE=1 SV=1 181 607 4.0E-23
sp|Q6H3Z6|YSL2_ORYSJ Metal-nicotianamine transporter YSL2 OS=Oryza sativa subsp. japonica GN=YSL2 PE=2 SV=2 202 604 7.0E-23
sp|Q6H7J6|YSL14_ORYSJ Probable metal-nicotianamine transporter YSL14 OS=Oryza sativa subsp. japonica GN=YSL14 PE=2 SV=1 181 604 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53134|YGL4_YEAST Putative oligopeptide transporter YGL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL114W PE=1 SV=1 2 610 7.0E-144
sp|Q6R3K9|YSL2_ARATH Metal-nicotianamine transporter YSL2 OS=Arabidopsis thaliana GN=YSL2 PE=1 SV=1 183 604 1.0E-24
sp|Q9LUN2|YSL5_ARATH Probable metal-nicotianamine transporter YSL5 OS=Arabidopsis thaliana GN=YSL5 PE=1 SV=1 181 607 4.0E-23
sp|Q6H3Z6|YSL2_ORYSJ Metal-nicotianamine transporter YSL2 OS=Oryza sativa subsp. japonica GN=YSL2 PE=2 SV=2 202 604 7.0E-23
sp|Q6H7J6|YSL14_ORYSJ Probable metal-nicotianamine transporter YSL14 OS=Oryza sativa subsp. japonica GN=YSL14 PE=2 SV=1 181 604 5.0E-22
sp|Q9SHY2|YSL7_ARATH Probable metal-nicotianamine transporter YSL7 OS=Arabidopsis thaliana GN=YSL7 PE=2 SV=1 183 604 6.0E-22
sp|Q7XN54|YSL16_ORYSJ Probable metal-nicotianamine transporter YSL16 OS=Oryza sativa subsp. japonica GN=YSL16 PE=2 SV=2 202 604 1.0E-21
sp|Q6H3Z3|YSL15_ORYSJ Iron-phytosiderophore transporter YSL15 OS=Oryza sativa subsp. japonica GN=YSL15 PE=2 SV=1 202 604 1.0E-21
sp|Q6R3L0|YSL1_ARATH Metal-nicotianamine transporter YSL1 OS=Arabidopsis thaliana GN=YSL1 PE=2 SV=2 202 604 1.0E-20
sp|Q7XRV2|YSL6_ORYSJ Probable metal-nicotianamine transporter YSL6 OS=Oryza sativa subsp. japonica GN=YSL6 PE=2 SV=1 183 607 1.0E-20
sp|Q6R3K4|YSL8_ARATH Probable metal-nicotianamine transporter YSL8 OS=Arabidopsis thaliana GN=YSL8 PE=1 SV=2 192 604 3.0E-20
sp|Q5JQD7|YSL12_ORYSJ Probable metal-nicotianamine transporter YSL12 OS=Oryza sativa subsp. japonica GN=YSL12 PE=2 SV=2 181 604 6.0E-20
sp|Q6AVD0|YSL3_ORYSJ Probable metal-nicotianamine transporter YSL3 OS=Oryza sativa subsp. japonica GN=YSL3 PE=2 SV=2 181 607 4.0E-19
sp|Q941V3|YSL18_ORYSJ Probable metal-nicotianamine transporter YSL18 OS=Oryza sativa subsp. japonica GN=YSL18 PE=2 SV=1 183 607 6.0E-19
sp|Q2EF88|YSL3_ARATH Metal-nicotianamine transporter YSL3 OS=Arabidopsis thaliana GN=YSL3 PE=2 SV=1 183 604 3.0E-18
sp|Q7XKF4|YSL13_ORYSJ Probable metal-nicotianamine transporter YSL13 OS=Oryza sativa subsp. japonica GN=YSL13 PE=2 SV=2 181 604 6.0E-18
sp|Q7XRV1|YSL5_ORYSJ Probable metal-nicotianamine transporter YSL5 OS=Oryza sativa subsp. japonica GN=YSL5 PE=2 SV=3 183 607 7.0E-18
sp|Q6R3K6|YSL6_ARATH Probable metal-nicotianamine transporter YSL6 OS=Arabidopsis thaliana GN=YSL6 PE=2 SV=2 181 604 1.0E-17
sp|Q7XUJ2|YSL9_ORYSJ Probable metal-nicotianamine transporter YSL9 OS=Oryza sativa subsp. japonica GN=YSL9 PE=2 SV=2 202 604 1.0E-17
sp|Q6ZGM7|YSL7_ORYSJ Probable metal-nicotianamine transporter YSL7 OS=Oryza sativa subsp. japonica GN=YSL7 PE=2 SV=1 160 604 6.0E-17
sp|Q0J932|YSL10_ORYSJ Probable metal-nicotianamine transporter YSL10 OS=Oryza sativa subsp. japonica GN=YSL10 PE=2 SV=2 183 604 5.0E-16
sp|Q7X660|YSL11_ORYSJ Probable metal-nicotianamine transporter YSL11 OS=Oryza sativa subsp. japonica GN=YSL11 PE=2 SV=1 181 604 3.0E-15
sp|Q0E4J6|YSL8_ORYSJ Probable metal-nicotianamine transporter YSL8 OS=Oryza sativa subsp. japonica GN=YSL8 PE=2 SV=1 156 607 1.0E-14
sp|Q9AY27|YS1_MAIZE Iron-phytosiderophore transporter yellow stripe 1 OS=Zea mays GN=YS1 PE=2 SV=1 202 604 2.0E-14
sp|Q688S6|YSL4_ORYSJ Probable metal-nicotianamine transporter YSL4 OS=Oryza sativa subsp. japonica GN=YSL4 PE=2 SV=1 197 607 2.0E-12
sp|Q6ZCX1|YSL17_ORYSJ Probable metal-nicotianamine transporter YSL17 OS=Oryza sativa subsp. japonica GN=YSL17 PE=2 SV=1 396 604 5.0E-12
sp|Q6R3K8|YSL4_ARATH Probable metal-nicotianamine transporter YSL4 OS=Arabidopsis thaliana GN=YSL4 PE=2 SV=1 181 604 5.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 33 51 18
2 160 182 22
3 192 214 22
4 221 240 19
5 255 277 22
6 347 369 22
7 374 396 22
8 426 445 19
9 465 482 17
10 489 511 22
11 521 543 22
12 550 569 19
13 589 611 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8451
MPLGCGFVGVIPAMNYLLTPNEWGPLSLRLDQLVVWSLGLCYFGVVFAVPLRHQVIVRERLRFPSGFSTAVLITV
LHGHWRPSADKEALDAAARGGYASLVPRNDSPNPPSAEVRSAEPSASGQEPEPEPEPEPELESESESEPDAQSFD
PSDWAYNMRLLMVSFCMSGAFTICTYFFPVLRNIPILGTGAASSWLWTLNPSLAYVGQGIIMGVETTMHMTFGAI
IGWGILSPLAKFRGWAPGPVDDWQHGSKGWIVWISLAIMLVDAVISLCFVALRSVVGIRFTSLLGCTMLRLRGSW
NSFGRRAAYHPLPSDEQQRQDPAHIVQSTCGQDEQLKDAPADQRIDVRLVVAGLLASIFLCIGTVHAVFGNLVPI
YATIVAVLMALVLSIMGVRALGETDLNPVSGISKLAQLFFAIIVPQTSKSSVLINLVAGAISEAGALQAGDLMQD
LKTGHLLGASPKAQFWGQMIGATVGAILSALLYRLYTKVYTIPGELFQVPTAYVWIFTARLVTGQGLPPMASQWA
TGAGAFFTLTTMARIASVGRAWRSWVPGGIAVAVGMYNVPSFTLGRAAGGLIGWFWTRIMQRSGTPLIIIASGFI
LGEGCFSPLHFRKSQD
Coding >Ophio5|8451
ATGCCTCTCGGCTGCGGGTTCGTCGGAGTCATTCCGGCTATGAATTACCTATTAACACCTAACGAATGGGGCCCT
CTATCTTTGCGTCTTGATCAACTGGTCGTCTGGTCCCTCGGCCTCTGCTATTTCGGTGTCGTATTTGCCGTACCT
TTGCGCCACCAGGTGATTGTACGGGAGCGTCTGAGGTTCCCAAGTGGCTTCAGCACAGCGGTTCTTATTACCGTC
TTGCATGGTCACTGGCGGCCCTCCGCCGACAAGGAAGCCCTTGATGCGGCTGCCCGGGGAGGATATGCCAGCCTG
GTGCCTCGCAATGACTCCCCCAATCCACCCTCCGCGGAGGTAAGAAGTGCCGAACCTAGTGCTTCGGGCCAGGAG
CCGGAGCCGGAGCCGGAGCCGGAGCCGGAGTTGGAGTCGGAGTCGGAGTCGGAGCCGGATGCGCAGTCATTTGAT
CCTTCTGACTGGGCATACAACATGCGGCTCTTGATGGTGTCGTTCTGCATGTCCGGCGCATTCACAATTTGCACT
TATTTCTTCCCAGTCCTGAGGAACATCCCTATCCTGGGTACTGGCGCGGCTAGCAGCTGGCTCTGGACTTTGAAC
CCAAGCCTGGCATATGTCGGGCAAGGTATAATAATGGGTGTCGAAACGACAATGCACATGACATTTGGTGCAATC
ATCGGTTGGGGTATTCTTAGCCCCTTGGCGAAATTCAGGGGCTGGGCTCCTGGCCCAGTCGATGACTGGCAACAC
GGAAGCAAGGGCTGGATTGTCTGGATTTCGCTCGCCATTATGCTCGTCGATGCCGTGATTAGTCTTTGCTTTGTT
GCTTTGCGTTCCGTTGTGGGCATCCGGTTTACCAGCTTGCTTGGGTGTACGATGCTGCGGCTCCGTGGCTCATGG
AACTCATTTGGGCGTCGCGCTGCATACCACCCTCTGCCGAGCGACGAGCAACAACGCCAAGACCCAGCTCACATT
GTTCAGAGCACTTGCGGCCAAGATGAGCAGCTCAAAGATGCGCCTGCAGATCAGCGTATCGATGTCCGCTTGGTG
GTTGCCGGGCTACTTGCGTCCATCTTCCTATGCATCGGGACGGTGCACGCCGTGTTTGGAAATCTCGTCCCCATC
TATGCGACCATCGTCGCCGTCCTCATGGCACTTGTTCTCAGCATCATGGGCGTCAGAGCTCTCGGTGAAACGGAC
CTAAATCCTGTTTCTGGAATCAGCAAATTGGCCCAGCTGTTCTTTGCCATCATCGTTCCACAGACCAGCAAATCA
AGCGTCCTCATCAATCTAGTCGCTGGTGCCATTTCCGAAGCCGGCGCATTGCAGGCTGGTGATCTGATGCAGGAT
CTGAAGACTGGCCACCTTCTCGGCGCTTCGCCAAAAGCGCAGTTCTGGGGTCAGATGATTGGTGCTACTGTCGGT
GCCATTCTGAGTGCACTTCTATATCGCCTTTATACCAAGGTTTACACGATCCCCGGTGAGCTCTTTCAGGTCCCT
ACTGCGTATGTGTGGATCTTCACCGCCAGACTTGTGACGGGGCAGGGTCTGCCACCGATGGCGAGCCAGTGGGCA
ACAGGCGCAGGTGCCTTCTTCACTCTTACGACAATGGCTAGGATTGCTTCAGTTGGGAGAGCTTGGCGATCGTGG
GTTCCAGGAGGGATTGCTGTCGCCGTCGGCATGTACAACGTTCCGTCCTTCACCTTGGGCAGAGCCGCAGGGGGA
TTGATTGGCTGGTTTTGGACTCGAATCATGCAACGATCTGGTACCCCCCTGATCATCATAGCTTCTGGCTTTATC
CTCGGCGAGGGTTGCTTCTCTCCCTTGCATTTCAGAAAATCCCAAGAT
Transcript >Ophio5|8451
ATGCCTCTCGGCTGCGGGTTCGTCGGAGTCATTCCGGCTATGAATTACCTATTAACACCTAACGAATGGGGCCCT
CTATCTTTGCGTCTTGATCAACTGGTCGTCTGGTCCCTCGGCCTCTGCTATTTCGGTGTCGTATTTGCCGTACCT
TTGCGCCACCAGGTGATTGTACGGGAGCGTCTGAGGTTCCCAAGTGGCTTCAGCACAGCGGTTCTTATTACCGTC
TTGCATGGTCACTGGCGGCCCTCCGCCGACAAGGAAGCCCTTGATGCGGCTGCCCGGGGAGGATATGCCAGCCTG
GTGCCTCGCAATGACTCCCCCAATCCACCCTCCGCGGAGGTAAGAAGTGCCGAACCTAGTGCTTCGGGCCAGGAG
CCGGAGCCGGAGCCGGAGCCGGAGCCGGAGTTGGAGTCGGAGTCGGAGTCGGAGCCGGATGCGCAGTCATTTGAT
CCTTCTGACTGGGCATACAACATGCGGCTCTTGATGGTGTCGTTCTGCATGTCCGGCGCATTCACAATTTGCACT
TATTTCTTCCCAGTCCTGAGGAACATCCCTATCCTGGGTACTGGCGCGGCTAGCAGCTGGCTCTGGACTTTGAAC
CCAAGCCTGGCATATGTCGGGCAAGGTATAATAATGGGTGTCGAAACGACAATGCACATGACATTTGGTGCAATC
ATCGGTTGGGGTATTCTTAGCCCCTTGGCGAAATTCAGGGGCTGGGCTCCTGGCCCAGTCGATGACTGGCAACAC
GGAAGCAAGGGCTGGATTGTCTGGATTTCGCTCGCCATTATGCTCGTCGATGCCGTGATTAGTCTTTGCTTTGTT
GCTTTGCGTTCCGTTGTGGGCATCCGGTTTACCAGCTTGCTTGGGTGTACGATGCTGCGGCTCCGTGGCTCATGG
AACTCATTTGGGCGTCGCGCTGCATACCACCCTCTGCCGAGCGACGAGCAACAACGCCAAGACCCAGCTCACATT
GTTCAGAGCACTTGCGGCCAAGATGAGCAGCTCAAAGATGCGCCTGCAGATCAGCGTATCGATGTCCGCTTGGTG
GTTGCCGGGCTACTTGCGTCCATCTTCCTATGCATCGGGACGGTGCACGCCGTGTTTGGAAATCTCGTCCCCATC
TATGCGACCATCGTCGCCGTCCTCATGGCACTTGTTCTCAGCATCATGGGCGTCAGAGCTCTCGGTGAAACGGAC
CTAAATCCTGTTTCTGGAATCAGCAAATTGGCCCAGCTGTTCTTTGCCATCATCGTTCCACAGACCAGCAAATCA
AGCGTCCTCATCAATCTAGTCGCTGGTGCCATTTCCGAAGCCGGCGCATTGCAGGCTGGTGATCTGATGCAGGAT
CTGAAGACTGGCCACCTTCTCGGCGCTTCGCCAAAAGCGCAGTTCTGGGGTCAGATGATTGGTGCTACTGTCGGT
GCCATTCTGAGTGCACTTCTATATCGCCTTTATACCAAGGTTTACACGATCCCCGGTGAGCTCTTTCAGGTCCCT
ACTGCGTATGTGTGGATCTTCACCGCCAGACTTGTGACGGGGCAGGGTCTGCCACCGATGGCGAGCCAGTGGGCA
ACAGGCGCAGGTGCCTTCTTCACTCTTACGACAATGGCTAGGATTGCTTCAGTTGGGAGAGCTTGGCGATCGTGG
GTTCCAGGAGGGATTGCTGTCGCCGTCGGCATGTACAACGTTCCGTCCTTCACCTTGGGCAGAGCCGCAGGGGGA
TTGATTGGCTGGTTTTGGACTCGAATCATGCAACGATCTGGTACCCCCCTGATCATCATAGCTTCTGGCTTTATC
CTCGGCGAGGGTTGCTTCTCTCCCTTGCATTTCAGAAAATCCCAAGATTGA
Gene >Ophio5|8451
ATGCCTCTCGGCTGCGGGTTCGTCGGAGTCGTCAGTACAGCCTGTTTCAGCGCGCCTGCCCTGCCGTAGCACATC
CTCACCAATCTTTCACAGATTCCGGCTATGAATTACCTATTAACACCTAACGAATGGGGCCCTCTATCTTTGCGT
CTTGATCAACTGGTCGTCTGGTCCCTCGGCCTCTGCTATTTCGGTGTCGTATTTGCCGTACCTTTGTGAGAACTT
CCTCGCCTGTACACACCTACATGTTCGAAGTCCTAGCTTCACTTCGTCCGAGTGTTTTGGCTGATGGAAGACCCT
GTTACTGTTTTGGCACAGGCGCCACCAGGTGATTGTACGGGAGCGTCTGAGGTTCCCAAGTGGCTTCAGCACAGC
GGTTCTTATTACCGTCTTGCATGGTCACTGGCGGCCCTCCGCCGACAAGGAAGCCCTTGATGCGGCTGCCCGGGG
AGGATATGCCAGCCTGGTGCCTCGCAATGACTCCCCCAATCCACCCTCCGCGGAGGTAAGAAGTGCCGAACCTAG
TGCTTCGGGCCAGGAGCCGGAGCCGGAGCCGGAGCCGGAGCCGGAGTTGGAGTCGGAGTCGGAGTCGGAGCCGGA
TGCGCAGTCATTTGATCCTTCTGACTGGGCATACAACATGCGGCTCTTGATGGTGTCGTTCTGCATGTCCGGCGC
ATTCACAATTTGCACTTATTTCTTCCCAGTCCTGAGGAACATCCCTATCCTGGGTACTGGCGCGGCTAGCAGCTG
GCTCTGGACTTTGAACCCAAGCCTGGCATATGTCGGGCAAGGTATAATAATGGGTGTCGAAACGACAATGCACAT
GACATTTGGTGCAATCATCGGTTGGGGTATTCTTAGCCCCTTGGCGAAATTCAGGGGCTGGGCTCCTGGCCCAGT
CGATGACTGGCAACACGGAAGCAAGGGCTGGATTGTCTGGATTTCGCTCGCCATTATGCTCGTCGATGCCGTGAT
TAGTCTTTGCTTTGTTGCTTTGCGTTCCGTTGTGGGCATCCGGTTTACCAGCTTGCTTGGGTGTACGATGCTGCG
GCTCCGTGGCTCATGGAACTCATTTGGGCGTCGCGCTGCATACCACCCTCTGCCGAGCGACGAGCAACAACGCCA
AGACCCAGCTCACATTGTTCAGAGCACTTGCGGCCAAGATGAGCAGCTCAAAGATGCGCCTGCAGATCAGCGTAT
CGATGTCCGCTTGGTGGTTGCCGGGCTACTTGCGTCCATCTTCCTATGCATCGGGACGGTGCACGCCGTGTTTGG
AAATCTCGTCCCCATCTATGCGACCATCGTCGCCGTCCTCATGGCACTTGTTCTCAGCATCATGGGCGTCAGAGC
TCTCGGTGAAACGGACCTAAATCCTGTTTCTGGAATCAGCAAATTGGCCCAGCTGTTCTTTGCCATCATCGTTCC
ACAGACCAGCAAATCAAGCGTCCTCATCAATCTAGTCGCTGGTGCCATTGTACGTACCCTCTCCGCTTCAAAGCC
CTTCAGCTTAGACTCGTCGCGTGGATTCTTCATCGAATGGCATTTCCCTCTGTCGTCCTTCGAACGCGAATCGTG
CCACTGACCGATAATCTGCAGTCCGAAGCCGTGAGTCTTTTGTCGCGATGACACGGCGTACCTGAGTGGCGATGC
TCACGCTGAAGATATAGGGCGCATTGCAGGCTGGTGATCTGATGCAGGATCTGAAGACTGGCCACCTTCTCGGCG
CTTCGCCAAAAGCGCAGTTCTGGGGTCAGATGATTGGTGCTACTGTCGGTGCCATTCTGAGTGCACTTCTATATC
GCCTTTATACCAAGTTGGTCAAATATCTATCCCCCGCTTCGTGTGTATATTTAGAAGCCTTGTTAACAGCAGACC
AAATCCAGGGTTTACACGATCCCCGGTGAGCTCTTTCAGGTCCCTACTGCGTATGTGTGGATCTTCACCGCCAGA
CTTGTGACGGGGCAGGGTCTGCCACCGATGGCGAGCCAGTGGGCAACAGGCGCAGGTGCCTTCTTCACTCTTACG
ACAATGGCTAGGATTGCTTCAGTTGGGAGAGCTTGGCGATCGTGGGTTCCAGGAGGGATTGCTGTCGCCGTCGGT
AAGCCAAATATCCGGAGGGATTGCTGCTAGGCTTCGCTGAGAGACAACCGCAGGCATGTACAACGTTCCGTCCTT
CACCTTGGGCAGAGCCGCAGGGGGATTGATTGGCTGGTTTTGGACTCGAATCATGCAACGATCTGGTACCCCCCT
GATCATCATAGCTTCTGTGAGGCTGCATGCATAAAACTGAAAGATCGAGATGCCGAAGCTGACCTATCTCAAGGG
CTTTATCCTCGGCGAGGGGTTCCTCAGCATTTTCAATTTGATCTTACAGAGCTTCAGCGTGCCGCATTTCTGAAT
TAAAGTTGCTTCTCTCCCTTGCATTTCAGAAAGTATGGACCAAACTCCGTCTAACCGTCAACCACTGCGCTAAGA
CTCTGCGTCTGCCTTCACTTCAGATCCCAAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail