Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8443
Gene name
Locationscaffold_94:35741..36221
Strand-
Gene length (bp)480
Transcript length (bp)480
Coding sequence length (bp)477
Protein length (aa) 159

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05620 TMEM208_SND2 SRP-independent targeting protein 2/TMEM208 5.6E-50 1 156

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14193|MUG69_SCHPO Meiotically up-regulated gene 69 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug69 PE=1 SV=4 1 128 9.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 20 38 18
2 43 65 22
3 86 108 22
4 112 134 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8443
MAQKAKKDLARNNAAALNRLHLISLLANGFFLLSHLFLRRRSLLAYGLLSLPALVCQYVLEISGRPKYDAVSGAL
KSSGQDLAARGLTEYMFDVVWVTWVCCAAVVLAGNWAWLLWAVIPAYGIYLGAGLVGMGRQQLAGMHSAQGAVPP
PNRRARRAA
Coding >Ophio5|8443
ATGGCCCAGAAAGCCAAAAAGGACCTCGCGAGGAATAATGCGGCCGCTCTCAATCGTCTGCATCTGATCTCTCTC
CTCGCAAACGGCTTCTTCCTGCTCTCGCACTTGTTCCTGCGCCGCCGCTCCCTGCTCGCCTACGGCCTGCTATCG
CTGCCGGCCTTGGTCTGCCAGTACGTGCTCGAGATCTCGGGCCGTCCCAAGTACGATGCTGTCTCCGGCGCGCTC
AAGAGCTCCGGTCAGGATCTGGCCGCTAGGGGCTTGACAGAGTACATGTTCGACGTCGTCTGGGTCACTTGGGTC
TGCTGCGCCGCCGTCGTGCTGGCCGGCAACTGGGCCTGGCTCTTGTGGGCCGTCATTCCAGCCTATGGCATCTAT
CTCGGCGCCGGCCTCGTCGGCATGGGCCGCCAGCAACTCGCCGGGATGCACTCCGCTCAGGGCGCCGTTCCTCCG
CCTAATCGCCGAGCCAGGCGAGCTGCG
Transcript >Ophio5|8443
ATGGCCCAGAAAGCCAAAAAGGACCTCGCGAGGAATAATGCGGCCGCTCTCAATCGTCTGCATCTGATCTCTCTC
CTCGCAAACGGCTTCTTCCTGCTCTCGCACTTGTTCCTGCGCCGCCGCTCCCTGCTCGCCTACGGCCTGCTATCG
CTGCCGGCCTTGGTCTGCCAGTACGTGCTCGAGATCTCGGGCCGTCCCAAGTACGATGCTGTCTCCGGCGCGCTC
AAGAGCTCCGGTCAGGATCTGGCCGCTAGGGGCTTGACAGAGTACATGTTCGACGTCGTCTGGGTCACTTGGGTC
TGCTGCGCCGCCGTCGTGCTGGCCGGCAACTGGGCCTGGCTCTTGTGGGCCGTCATTCCAGCCTATGGCATCTAT
CTCGGCGCCGGCCTCGTCGGCATGGGCCGCCAGCAACTCGCCGGGATGCACTCCGCTCAGGGCGCCGTTCCTCCG
CCTAATCGCCGAGCCAGGCGAGCTGCGTGA
Gene >Ophio5|8443
ATGGCCCAGAAAGCCAAAAAGGACCTCGCGAGGAATAATGCGGCCGCTCTCAATCGTCTGCATCTGATCTCTCTC
CTCGCAAACGGCTTCTTCCTGCTCTCGCACTTGTTCCTGCGCCGCCGCTCCCTGCTCGCCTACGGCCTGCTATCG
CTGCCGGCCTTGGTCTGCCAGTACGTGCTCGAGATCTCGGGCCGTCCCAAGTACGATGCTGTCTCCGGCGCGCTC
AAGAGCTCCGGTCAGGATCTGGCCGCTAGGGGCTTGACAGAGTACATGTTCGACGTCGTCTGGGTCACTTGGGTC
TGCTGCGCCGCCGTCGTGCTGGCCGGCAACTGGGCCTGGCTCTTGTGGGCCGTCATTCCAGCCTATGGCATCTAT
CTCGGCGCCGGCCTCGTCGGCATGGGCCGCCAGCAACTCGCCGGGATGCACTCCGCTCAGGGCGCCGTTCCTCCG
CCTAATCGCCGAGCCAGGCGAGCTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail