Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8439
Gene name
Locationscaffold_94:25917..29125
Strand-
Gene length (bp)3208
Transcript length (bp)2970
Coding sequence length (bp)2967
Protein length (aa) 989

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 2.3E-31 715 928
PF11522 Pik1 Yeast phosphatidylinositol-4-OH kinase Pik1 6.5E-19 109 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 4 989 0.0E+00
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 313 989 6.0E-150
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 20 989 5.0E-147
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 571 989 9.0E-121
sp|B3EX61|PI4KB_SORAR Phosphatidylinositol 4-kinase beta OS=Sorex araneus GN=PI4KB PE=3 SV=1 663 988 6.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 4 989 0.0E+00
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 313 989 6.0E-150
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 20 989 5.0E-147
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 571 989 9.0E-121
sp|B3EX61|PI4KB_SORAR Phosphatidylinositol 4-kinase beta OS=Sorex araneus GN=PI4KB PE=3 SV=1 663 988 6.0E-74
sp|O08561|PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus GN=Pi4kb PE=1 SV=1 663 988 2.0E-73
sp|Q8BKC8|PI4KB_MOUSE Phosphatidylinositol 4-kinase beta OS=Mus musculus GN=Pi4kb PE=1 SV=2 663 988 3.0E-73
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 680 989 3.0E-73
sp|Q49GP3|PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio GN=pi4kb PE=2 SV=2 663 988 3.0E-73
sp|A9X1A0|PI4KB_PAPAN Phosphatidylinositol 4-kinase beta OS=Papio anubis GN=PI4KB PE=3 SV=2 663 988 3.0E-73
sp|B4UT09|PI4KB_OTOGA Phosphatidylinositol 4-kinase beta OS=Otolemur garnettii GN=PI4KB PE=3 SV=1 663 988 3.0E-73
sp|Q9UBF8|PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens GN=PI4KB PE=1 SV=1 663 988 4.0E-73
sp|B1MTG7|PI4KB_CALMO Phosphatidylinositol 4-kinase beta OS=Callicebus moloch GN=PI4KB PE=3 SV=1 663 988 4.0E-73
sp|B0KWC1|PI4KB_CALJA Phosphatidylinositol 4-kinase beta OS=Callithrix jacchus GN=PI4KB PE=3 SV=1 663 988 4.0E-73
sp|B2KI64|PI4KB_RHIFE Phosphatidylinositol 4-kinase beta OS=Rhinolophus ferrumequinum GN=PI4KB PE=3 SV=1 663 988 5.0E-73
sp|A4IID4|PI4KB_XENTR Phosphatidylinositol 4-kinase beta OS=Xenopus tropicalis GN=pi4kb PE=2 SV=1 663 988 5.0E-73
sp|Q6GN16|PI4KB_XENLA Phosphatidylinositol 4-kinase beta OS=Xenopus laevis GN=pi4kb PE=2 SV=1 663 988 7.0E-73
sp|O02810|PI4KB_BOVIN Phosphatidylinositol 4-kinase beta OS=Bos taurus GN=PI4KB PE=1 SV=2 663 988 3.0E-72
sp|Q9FMJ0|P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana GN=PI4KB1 PE=1 SV=1 672 988 1.0E-64
sp|Q0WPX9|P4KB2_ARATH Phosphatidylinositol 4-kinase beta 2 OS=Arabidopsis thaliana GN=PI4KB2 PE=2 SV=1 652 988 3.0E-63
sp|P37297|STT4_YEAST Phosphatidylinositol 4-kinase STT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STT4 PE=1 SV=1 709 988 4.0E-47
sp|Q9USR3|STT4_SCHPO Phosphatidylinositol 4-kinase stt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stt4 PE=3 SV=1 635 988 4.0E-46
sp|Q8SQY7|STT4_ENCCU Probable phosphatidylinositol 4-kinase STT4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=STT4 PE=3 SV=2 717 988 5.0E-43
sp|O08662|PI4KA_RAT Phosphatidylinositol 4-kinase alpha OS=Rattus norvegicus GN=Pi4ka PE=1 SV=1 635 988 1.0E-38
sp|P42356|PI4KA_HUMAN Phosphatidylinositol 4-kinase alpha OS=Homo sapiens GN=PI4KA PE=1 SV=3 635 988 3.0E-38
sp|O02811|PI4KA_BOVIN Phosphatidylinositol 4-kinase alpha OS=Bos taurus GN=PI4KA PE=2 SV=1 635 988 4.0E-38
sp|Q9SXA1|P4KA1_ARATH Phosphatidylinositol 4-kinase alpha 1 OS=Arabidopsis thaliana GN=PI4KA1 PE=1 SV=2 716 988 4.0E-36
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 251 451 2.0E-34
sp|P54675|PI3K3_DICDI Phosphatidylinositol 3-kinase 3 OS=Dictyostelium discoideum GN=pikC PE=2 SV=2 715 977 9.0E-34
sp|A4QPH2|PI4P2_HUMAN Putative phosphatidylinositol 4-kinase alpha-like protein P2 OS=Homo sapiens GN=PI4KAP2 PE=5 SV=3 727 988 3.0E-32
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 14 275 6.0E-32
sp|Q9C680|P4KA2_ARATH Phosphatidylinositol 4-kinase alpha 2 OS=Arabidopsis thaliana GN=PI4KA2 PE=1 SV=1 716 988 6.0E-30
sp|P54674|PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum GN=pikB PE=2 SV=2 715 963 7.0E-29
sp|P54673|PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum GN=pikA PE=2 SV=2 711 983 6.0E-28
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 20 175 2.0E-27
sp|P54676|PI3K4_DICDI Phosphatidylinositol 3-kinase VPS34-like OS=Dictyostelium discoideum GN=pikE PE=3 SV=2 697 957 2.0E-27
sp|P48736|PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens GN=PIK3CG PE=1 SV=3 715 924 3.0E-26
sp|Q9JHG7|PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus GN=Pik3cg PE=1 SV=2 715 924 7.0E-26
sp|P42337|PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus GN=Pik3ca PE=1 SV=2 716 977 1.0E-25
sp|P42336|PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens GN=PIK3CA PE=1 SV=2 716 977 1.0E-25
sp|P32871|PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus GN=PIK3CA PE=1 SV=1 716 977 1.0E-25
sp|Q61194|P3C2A_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Mus musculus GN=Pik3c2a PE=1 SV=2 715 988 4.0E-25
sp|O02697|PK3CG_PIG Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Sus scrofa GN=PIK3CG PE=1 SV=2 715 924 1.0E-24
sp|O00443|P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens GN=PIK3C2A PE=1 SV=2 715 988 1.0E-24
sp|P42347|PI3K1_SOYBN Phosphatidylinositol 3-kinase, root isoform OS=Glycine max PE=2 SV=1 715 986 1.0E-24
sp|Q5RAY1|P3C2A_PONAB Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Pongo abelii GN=PIK3C2A PE=2 SV=1 715 988 3.0E-24
sp|P42348|PI3K2_SOYBN Phosphatidylinositol 3-kinase, nodule isoform OS=Glycine max PE=2 SV=1 715 986 4.0E-24
sp|O70167|P3C2G_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Mus musculus GN=Pik3c2g PE=2 SV=1 715 924 5.0E-24
sp|O00750|P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens GN=PIK3C2B PE=1 SV=2 715 912 8.0E-24
sp|O75747|P3C2G_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens GN=PIK3C2G PE=1 SV=3 715 914 1.0E-23
sp|P42339|PI3K_ARATH Phosphatidylinositol 3-kinase VPS34 OS=Arabidopsis thaliana GN=At1g60490 PE=2 SV=2 715 986 1.0E-23
sp|Q8BTI9|PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus GN=Pik3cb PE=1 SV=2 713 924 2.0E-23
sp|Q9Z1L0|PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus GN=Pik3cb PE=2 SV=1 713 924 2.0E-23
sp|O70173|P3C2G_RAT Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus GN=Pik3c2g PE=2 SV=1 715 914 5.0E-23
sp|P22543|VPS34_YEAST Phosphatidylinositol 3-kinase VPS34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS34 PE=1 SV=1 717 957 3.0E-22
sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2 717 979 5.0E-22
sp|P42338|PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens GN=PIK3CB PE=1 SV=1 713 924 1.0E-21
sp|Q6AZN6|PK3C3_XENLA Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Xenopus laevis GN=pik3c3 PE=2 SV=1 717 983 2.0E-21
sp|O35904|PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus GN=Pik3cd PE=1 SV=2 715 931 2.0E-21
sp|O00329|PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens GN=PIK3CD PE=1 SV=2 715 931 2.0E-21
sp|Q6PF93|PK3C3_MOUSE Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Mus musculus GN=Pik3c3 PE=1 SV=1 717 963 6.0E-21
sp|O88763|PK3C3_RAT Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Rattus norvegicus GN=Pik3c3 PE=1 SV=1 717 963 1.0E-19
sp|Q8NEB9|PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens GN=PIK3C3 PE=1 SV=1 717 963 1.0E-19
sp|Q5D891|PK3C3_PIG Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Sus scrofa GN=PIK3C3 PE=2 SV=1 717 963 1.0E-19
sp|Q94125|AGE1_CAEEL Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis elegans GN=age-1 PE=1 SV=6 714 924 8.0E-18
sp|P0C5E7|AGE1_CAEBR Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis briggsae GN=age-1 PE=3 SV=1 714 910 1.0E-17
sp|Q92213|VPS34_CANAX Phosphatidylinositol 3-kinase VPS34 OS=Candida albicans GN=VPS34 PE=3 SV=1 694 957 2.0E-16
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 717 938 4.0E-13
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 724 927 7.0E-13
sp|Q5UR69|YL615_MIMIV Putative phosphatidylinositol kinase L615 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L615 PE=3 SV=1 764 986 4.0E-12
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 751 927 6.0E-12
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 718 927 3.0E-11
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 718 927 1.0E-10
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 800 962 2.0E-10
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 724 938 2.0E-10
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 724 927 4.0E-10
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 800 921 4.0E-10
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 799 927 7.0E-10
sp|Q22258|ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans GN=atl-1 PE=2 SV=2 811 922 9.0E-10
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 822 927 9.0E-10
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 718 918 9.0E-10
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 800 927 9.0E-10
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 724 927 1.0E-09
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 724 938 1.0E-09
sp|Q9M3G7|ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana GN=ATM PE=2 SV=1 804 927 2.0E-09
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 822 927 3.0E-09
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 822 927 3.0E-09
sp|Q5EAK6|ATM_DROME Serine/threonine-protein kinase ATM OS=Drosophila melanogaster GN=tefu PE=2 SV=1 822 972 3.0E-09
sp|O74630|ATM_SCHPO Serine/threonine-protein kinase tel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tel1 PE=1 SV=1 792 950 4.0E-09
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 823 927 7.0E-09
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 823 927 7.0E-09
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 697 924 1.0E-08
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 20 122 3.0E-08
sp|Q9FMJ0|P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana GN=PI4KB1 PE=1 SV=1 6 104 3.0E-08
sp|Q0WPX9|P4KB2_ARATH Phosphatidylinositol 4-kinase beta 2 OS=Arabidopsis thaliana GN=PI4KB2 PE=2 SV=1 6 104 3.0E-08
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 697 927 5.0E-08
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 802 927 6.0E-08
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 804 927 9.0E-08
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 320 420 1.0E-07
sp|Q8BKX6|SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus GN=Smg1 PE=1 SV=3 822 927 1.0E-07
sp|Q96Q15|SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens GN=SMG1 PE=1 SV=3 822 927 1.0E-07
sp|Q6FX42|ATR_CANGA Serine/threonine-protein kinase MEC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEC1 PE=3 SV=1 799 930 1.0E-07
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 799 927 2.0E-07
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 811 918 2.0E-07
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 811 918 2.0E-07
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 811 918 3.0E-07
sp|Q49GP3|PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio GN=pi4kb PE=2 SV=2 327 417 2.0E-06
sp|P38111|ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEC1 PE=1 SV=1 751 930 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8439
MSWDLLQRFLESDVFNSNPFLSVSYLSRYADHVGIHHVLCNKLRQFPYEDIEFFLPQLCHLIISVDNESMALEEF
LLDLCEESATAALLTFWLFQTYLHDLSPNPQSGPFQTCRRVYNKVQHIVFGLADTARHGKIKENVLPVTVLSSFV
LASVALPMIPRWAGPLAVAQARKPQPATDVAPEPSSSPKPIRAQTVSVSTSRSRRAKELRKSTAPDAAGPSDPRP
HSSRSLSQAATSTAKRAKTPIGTKRPSALNLESLDARASSASLPLPSPKPTTRPATPVSADMPSADGMLRRHSHH
AKASRTADDLTLVQKTRLLRSHYFRSQTQFLTALEGISNRLVIVPKPARMSALRAELALVSRDLPAEVDIPVICP
PTLVNGSPGKSRHHRIVRLNPAEATVLNSAEKVPYLLMVEVLRDDFTFDPGTVDNRRLLATLLDGGGRSRRLFDL
SSETPRLSPTVARAPEPIVDSVFEPTSGDLGSSPLLKAEDEAPSRYGPPFRQPQAYTHTNQRLSSGATTQTSSTM
LEVVSPRTSGGASTSRSSSPSSRRKMTVTLPRNVAAAAPDQPDFSALATHMRTASQMLAQLDATSGKRPKHEVAA
IRAKIIASMQSLEEQSFEMEDQGPTFDAIIAKTSGGGGPSDPDLDDDDGDGPLDTAPNASAGRERMENDIKTGGV
QRRGDRDDPSAAVFGEAWEAKKERIRKSSPYGWMKNWDLVSVIVKTGADLRQEAFACQLIDVCHRIWVDADVDVW
VKLMRILVTGESSGLIETITNGVSLHSLKRSLTLAAADSGQAARQRIATLRDHFLKAFGQPESEPYRAGVDAFKR
SLAAYSIISYILQLKDRHNGNVLIDSEGHIIHIDFGFMLSNSPGSVGFEAAPFKLTHEYVDVLGGIGSPDFEDYK
RLCKQAFQALRRSADNIIDLVAMMGRDSSMPCFSVGVAHATNSLRQRFQLHLSAVEAEQFVETDLVGKSYGSYYT
RLYDTFQYRTQGIY
Coding >Ophio5|8439
ATGTCGTGGGACCTATTGCAAAGATTTCTCGAGTCCGACGTCTTCAATTCGAATCCCTTTCTCTCGGTCTCGTAT
CTCTCCCGGTACGCCGACCATGTCGGAATCCACCATGTCCTGTGCAACAAGCTGCGCCAATTTCCCTACGAAGAC
ATCGAGTTCTTTCTGCCCCAGCTGTGCCACCTCATAATCAGCGTCGACAATGAGTCCATGGCTCTCGAGGAGTTT
TTGTTGGATCTTTGCGAGGAGTCGGCCACGGCCGCCCTGCTGACCTTCTGGCTCTTCCAGACTTACCTACACGAC
CTCTCGCCGAATCCCCAGTCGGGCCCCTTTCAGACTTGCAGGCGCGTCTACAACAAAGTCCAGCACATCGTCTTC
GGCCTGGCCGACACCGCCCGACACGGCAAGATCAAGGAGAATGTCCTTCCGGTCACCGTCCTCTCCAGCTTCGTC
CTCGCTAGCGTCGCGTTGCCCATGATACCGAGATGGGCCGGACCTCTTGCCGTCGCCCAGGCGCGAAAGCCGCAG
CCTGCCACCGACGTGGCCCCAGAGCCCAGCTCCAGTCCCAAGCCCATTCGGGCGCAGACCGTGTCAGTTTCCACC
TCGAGGTCGAGACGCGCCAAGGAACTGAGGAAGTCGACCGCTCCCGACGCCGCCGGCCCATCGGACCCGCGCCCG
CACTCGTCCCGGAGCCTCTCGCAGGCGGCCACGTCGACGGCCAAGAGGGCCAAGACGCCAATCGGCACCAAGCGG
CCGTCTGCGCTCAATCTCGAGTCTCTCGACGCCCGGGCCAGCTCCGCATCGCTACCCTTGCCGTCGCCCAAGCCG
ACGACGAGACCGGCCACTCCCGTCTCCGCCGACATGCCGTCGGCCGACGGCATGCTCCGGCGGCACTCGCATCAC
GCCAAGGCCTCACGGACCGCCGATGACCTGACGCTGGTCCAGAAGACGCGCCTACTGAGGTCCCACTATTTCAGG
TCGCAGACGCAGTTTCTGACTGCTCTCGAGGGCATCTCCAACCGGCTTGTCATCGTGCCCAAGCCCGCCCGGATG
AGTGCGCTTCGAGCCGAGCTGGCCCTCGTCTCACGAGACCTGCCGGCCGAGGTCGACATCCCCGTCATCTGCCCT
CCGACGCTGGTCAACGGGTCACCCGGCAAGAGCCGACACCACAGGATCGTGCGGCTGAACCCGGCCGAGGCCACG
GTACTCAACAGCGCCGAAAAGGTGCCCTACCTCTTGATGGTCGAGGTTCTCCGAGACGACTTCACCTTCGACCCA
GGTACCGTCGACAACCGACGACTCCTCGCCACCTTGCTCGACGGCGGCGGGAGATCTCGGCGGCTCTTCGACCTA
TCGTCGGAGACGCCCAGGTTATCTCCGACGGTTGCGCGGGCCCCCGAGCCCATCGTCGACAGCGTCTTCGAGCCG
ACCTCGGGTGACCTGGGCAGCTCGCCTTTGCTCAAGGCCGAGGATGAGGCGCCTAGCAGATACGGGCCCCCTTTC
CGGCAGCCTCAGGCTTACACGCATACCAACCAGCGCCTGTCCAGCGGGGCGACGACGCAGACGTCGTCGACGATG
CTCGAGGTCGTCAGTCCGCGCACGTCGGGTGGGGCCTCGACGTCTAGGTCGAGCAGCCCCAGCTCCCGGCGCAAA
ATGACGGTGACGCTACCCCGGAATGTGGCCGCCGCGGCCCCCGACCAGCCCGACTTCTCGGCCCTGGCGACGCAC
ATGAGGACGGCCTCGCAGATGCTAGCGCAGCTCGACGCGACGAGCGGCAAGCGACCTAAGCACGAGGTGGCGGCC
ATCAGAGCCAAAATCATCGCGAGCATGCAGAGCCTGGAAGAGCAGAGCTTCGAGATGGAGGACCAGGGCCCAACA
TTTGACGCCATCATCGCCAAGACGAGCGGGGGCGGTGGTCCCAGCGACCCAGACCTCGACGACGACGACGGCGAC
GGGCCGCTGGACACGGCCCCAAACGCCAGCGCGGGCAGGGAGAGGATGGAGAACGACATCAAGACGGGTGGCGTC
CAGCGGCGGGGTGACCGCGACGATCCCAGCGCGGCCGTCTTTGGAGAGGCTTGGGAGGCCAAGAAGGAGCGGATT
CGCAAGTCGTCCCCCTACGGCTGGATGAAGAATTGGGACCTGGTCAGCGTCATTGTCAAGACGGGAGCCGACCTG
CGGCAGGAGGCCTTTGCTTGTCAGCTCATCGACGTCTGCCACCGGATCTGGGTCGACGCCGACGTCGATGTCTGG
GTCAAGCTGATGCGCATCCTGGTGACGGGCGAGTCGTCGGGCCTAATCGAGACCATCACCAACGGCGTCTCGCTC
CACTCGCTCAAGCGGAGCCTGACGCTGGCGGCGGCCGACTCGGGCCAGGCGGCGCGACAGCGCATCGCCACGCTG
CGCGACCATTTCCTCAAGGCCTTTGGCCAGCCGGAGAGTGAGCCGTACAGAGCCGGCGTCGACGCATTCAAGCGC
TCGCTAGCGGCCTACAGCATCATCTCGTACATCCTGCAGCTCAAGGACCGGCACAACGGCAACGTGCTTATCGAC
AGCGAGGGCCACATTATTCACATCGACTTTGGCTTTATGCTGTCCAATTCGCCCGGCTCCGTCGGGTTCGAGGCG
GCGCCTTTCAAGCTCACGCACGAGTACGTCGACGTGCTGGGCGGCATCGGGTCCCCGGACTTTGAGGACTACAAG
AGGCTGTGCAAGCAGGCATTTCAAGCGCTGCGCCGATCGGCGGACAACATCATTGATCTGGTCGCCATGATGGGC
CGCGACTCCAGCATGCCGTGCTTCTCGGTGGGCGTAGCTCACGCGACGAACAGCCTCCGACAGCGTTTCCAGCTA
CACCTCAGCGCCGTCGAGGCGGAGCAGTTTGTCGAGACGGATCTCGTGGGCAAGTCGTACGGGAGCTACTACACG
CGACTGTATGACACGTTCCAGTATCGGACTCAGGGCATCTAC
Transcript >Ophio5|8439
ATGTCGTGGGACCTATTGCAAAGATTTCTCGAGTCCGACGTCTTCAATTCGAATCCCTTTCTCTCGGTCTCGTAT
CTCTCCCGGTACGCCGACCATGTCGGAATCCACCATGTCCTGTGCAACAAGCTGCGCCAATTTCCCTACGAAGAC
ATCGAGTTCTTTCTGCCCCAGCTGTGCCACCTCATAATCAGCGTCGACAATGAGTCCATGGCTCTCGAGGAGTTT
TTGTTGGATCTTTGCGAGGAGTCGGCCACGGCCGCCCTGCTGACCTTCTGGCTCTTCCAGACTTACCTACACGAC
CTCTCGCCGAATCCCCAGTCGGGCCCCTTTCAGACTTGCAGGCGCGTCTACAACAAAGTCCAGCACATCGTCTTC
GGCCTGGCCGACACCGCCCGACACGGCAAGATCAAGGAGAATGTCCTTCCGGTCACCGTCCTCTCCAGCTTCGTC
CTCGCTAGCGTCGCGTTGCCCATGATACCGAGATGGGCCGGACCTCTTGCCGTCGCCCAGGCGCGAAAGCCGCAG
CCTGCCACCGACGTGGCCCCAGAGCCCAGCTCCAGTCCCAAGCCCATTCGGGCGCAGACCGTGTCAGTTTCCACC
TCGAGGTCGAGACGCGCCAAGGAACTGAGGAAGTCGACCGCTCCCGACGCCGCCGGCCCATCGGACCCGCGCCCG
CACTCGTCCCGGAGCCTCTCGCAGGCGGCCACGTCGACGGCCAAGAGGGCCAAGACGCCAATCGGCACCAAGCGG
CCGTCTGCGCTCAATCTCGAGTCTCTCGACGCCCGGGCCAGCTCCGCATCGCTACCCTTGCCGTCGCCCAAGCCG
ACGACGAGACCGGCCACTCCCGTCTCCGCCGACATGCCGTCGGCCGACGGCATGCTCCGGCGGCACTCGCATCAC
GCCAAGGCCTCACGGACCGCCGATGACCTGACGCTGGTCCAGAAGACGCGCCTACTGAGGTCCCACTATTTCAGG
TCGCAGACGCAGTTTCTGACTGCTCTCGAGGGCATCTCCAACCGGCTTGTCATCGTGCCCAAGCCCGCCCGGATG
AGTGCGCTTCGAGCCGAGCTGGCCCTCGTCTCACGAGACCTGCCGGCCGAGGTCGACATCCCCGTCATCTGCCCT
CCGACGCTGGTCAACGGGTCACCCGGCAAGAGCCGACACCACAGGATCGTGCGGCTGAACCCGGCCGAGGCCACG
GTACTCAACAGCGCCGAAAAGGTGCCCTACCTCTTGATGGTCGAGGTTCTCCGAGACGACTTCACCTTCGACCCA
GGTACCGTCGACAACCGACGACTCCTCGCCACCTTGCTCGACGGCGGCGGGAGATCTCGGCGGCTCTTCGACCTA
TCGTCGGAGACGCCCAGGTTATCTCCGACGGTTGCGCGGGCCCCCGAGCCCATCGTCGACAGCGTCTTCGAGCCG
ACCTCGGGTGACCTGGGCAGCTCGCCTTTGCTCAAGGCCGAGGATGAGGCGCCTAGCAGATACGGGCCCCCTTTC
CGGCAGCCTCAGGCTTACACGCATACCAACCAGCGCCTGTCCAGCGGGGCGACGACGCAGACGTCGTCGACGATG
CTCGAGGTCGTCAGTCCGCGCACGTCGGGTGGGGCCTCGACGTCTAGGTCGAGCAGCCCCAGCTCCCGGCGCAAA
ATGACGGTGACGCTACCCCGGAATGTGGCCGCCGCGGCCCCCGACCAGCCCGACTTCTCGGCCCTGGCGACGCAC
ATGAGGACGGCCTCGCAGATGCTAGCGCAGCTCGACGCGACGAGCGGCAAGCGACCTAAGCACGAGGTGGCGGCC
ATCAGAGCCAAAATCATCGCGAGCATGCAGAGCCTGGAAGAGCAGAGCTTCGAGATGGAGGACCAGGGCCCAACA
TTTGACGCCATCATCGCCAAGACGAGCGGGGGCGGTGGTCCCAGCGACCCAGACCTCGACGACGACGACGGCGAC
GGGCCGCTGGACACGGCCCCAAACGCCAGCGCGGGCAGGGAGAGGATGGAGAACGACATCAAGACGGGTGGCGTC
CAGCGGCGGGGTGACCGCGACGATCCCAGCGCGGCCGTCTTTGGAGAGGCTTGGGAGGCCAAGAAGGAGCGGATT
CGCAAGTCGTCCCCCTACGGCTGGATGAAGAATTGGGACCTGGTCAGCGTCATTGTCAAGACGGGAGCCGACCTG
CGGCAGGAGGCCTTTGCTTGTCAGCTCATCGACGTCTGCCACCGGATCTGGGTCGACGCCGACGTCGATGTCTGG
GTCAAGCTGATGCGCATCCTGGTGACGGGCGAGTCGTCGGGCCTAATCGAGACCATCACCAACGGCGTCTCGCTC
CACTCGCTCAAGCGGAGCCTGACGCTGGCGGCGGCCGACTCGGGCCAGGCGGCGCGACAGCGCATCGCCACGCTG
CGCGACCATTTCCTCAAGGCCTTTGGCCAGCCGGAGAGTGAGCCGTACAGAGCCGGCGTCGACGCATTCAAGCGC
TCGCTAGCGGCCTACAGCATCATCTCGTACATCCTGCAGCTCAAGGACCGGCACAACGGCAACGTGCTTATCGAC
AGCGAGGGCCACATTATTCACATCGACTTTGGCTTTATGCTGTCCAATTCGCCCGGCTCCGTCGGGTTCGAGGCG
GCGCCTTTCAAGCTCACGCACGAGTACGTCGACGTGCTGGGCGGCATCGGGTCCCCGGACTTTGAGGACTACAAG
AGGCTGTGCAAGCAGGCATTTCAAGCGCTGCGCCGATCGGCGGACAACATCATTGATCTGGTCGCCATGATGGGC
CGCGACTCCAGCATGCCGTGCTTCTCGGTGGGCGTAGCTCACGCGACGAACAGCCTCCGACAGCGTTTCCAGCTA
CACCTCAGCGCCGTCGAGGCGGAGCAGTTTGTCGAGACGGATCTCGTGGGCAAGTCGTACGGGAGCTACTACACG
CGACTGTATGACACGTTCCAGTATCGGACTCAGGGCATCTACTAG
Gene >Ophio5|8439
ATGTCGTGGGACCTATTGCAAAGATTTCTCGAGTCCGACGTCTTCAATTCGAATCCCTTTCTCTCGGTCTCGTAT
CTCTCGTACGTCCTGATTGCCCGCGCCGTTTCCCCCGCCTCCCCCCCCTCCCTCATCTCGTGTCCTCGCTGAAGG
CTCGGCAGCCGGTACGCCGACCATGTCGGAATCCACCATGTCCTGTGCAACAAGCTGCGCCAATTTCCCTACGAA
GACATCGAGTTCTTTCTGCCCCAGCTGTGCCACCTCATAATCAGCGTCGACAATGAGTCCATGGCTCTCGAGGAG
TTTTTGTTGGATCTTTGCGAGGAGTCGGCCACGGCCGCCCTGCTGGTACGGCTTGCATCCCCCCCCCCCCCCTTT
TAACAGCATTCACTGCTGACGGCGGCTACAGACCTTCTGGCTCTTCCAGACTTACCTACACGACCTCTCGCCGAA
TCCCCAGTCGGGCCCCTTTCAGACTTGCAGGCGCGTCTACAACAAAGTCCAGCACATCGTCTTCGGCCTGGCCGA
CACCGCCCGACACGGCAAGATCAAGGAGAATGTCCTTCCGGTCACCGTCCTCTCCAGCTTCGTCCTCGCTAGCGT
CGCGTTGCCCATGATACCGAGATGGGCCGGACCTCTTGCCGTCGCCCAGGCGCGAAAGCCGCAGCCTGCCACCGA
CGTGGCCCCAGAGCCCAGCTCCAGTCCCAAGCCCATTCGGGCGCAGACCGTGTCAGTTTCCACCTCGAGGTCGAG
ACGCGCCAAGGAACTGAGGAAGTCGACCGCTCCCGACGCCGCCGGCCCATCGGACCCGCGCCCGCACTCGTCCCG
GAGCCTCTCGCAGGCGGCCACGTCGACGGCCAAGAGGGCCAAGACGCCAATCGGCACCAAGCGGCCGTCTGCGCT
CAATCTCGAGTCTCTCGACGCCCGGGCCAGCTCCGCATCGCTACCCTTGCCGTCGCCCAAGCCGACGACGAGACC
GGCCACTCCCGTCTCCGCCGACATGCCGTCGGCCGACGGCATGCTCCGGCGGCACTCGCATCACGCCAAGGCCTC
ACGGACCGCCGATGACCTGACGCTGGTCCAGAAGACGCGCCTACTGAGGTCCCACTATTTCAGGTCGCAGACGCA
GTTTCTGACTGCTCTCGAGGGCATCTCCAACCGGCTTGTCATCGTGCCCAAGCCCGCCCGGATGAGTGCGCTTCG
AGCCGAGCTGGCCCTCGTCTCACGAGACCTGCCGGCCGAGGTCGACATCCCCGTCATCTGCCCTCCGACGCTGGT
CAACGGGTCACCCGGCAAGAGCCGACACCACAGGATCGTGCGGCTGAACCCGGCCGAGGCCACGGTACTCAACAG
CGCCGAAAAGGTGCCCTACCTCTTGATGGTCGAGGTTCTCCGAGACGACTTCACCTTCGACCCAGGTACCGTCGA
CAACCGACGACTCCTCGCCACCTTGCTCGACGGCGGCGGGAGATCTCGGCGGCTCTTCGACCTATCGTCGGAGAC
GCCCAGGTTATCTCCGACGGTTGCGCGGGCCCCCGAGCCCATCGTCGACAGCGTCTTCGAGCCGACCTCGGGTGA
CCTGGGCAGCTCGCCTTTGCTCAAGGCCGAGGATGAGGCGCCTAGCAGATACGGGCCCCCTTTCCGGCAGCCTCA
GGCTTACACGCATACCAACCAGCGCCTGTCCAGCGGGGCGACGACGCAGACGTCGTCGACGATGCTCGAGGTCGT
CAGTCCGCGCACGTCGGGTGGGGCCTCGACGTCTAGGTCGAGCAGCCCCAGCTCCCGGCGCAAAATGACGGTGAC
GCTACCCCGGAATGTGGCCGCCGCGGCCCCCGACCAGCCCGACTTCTCGGCCCTGGCGACGCACATGAGGACGGC
CTCGCAGATGCTAGCGCAGCTCGACGCGACGAGCGGCAAGCGACCTAAGCACGAGGTGGCGGCCATCAGAGCCAA
AATCATCGCGAGCATGCAGAGCCTGGAAGAGCAGAGCTTCGAGATGGAGGACCAGGGCCCAACATTTGACGCCAT
CATCGCCAAGACGAGCGGGGGCGGTGGTCCCAGCGACCCAGACCTCGACGACGACGACGGCGACGGGCCGCTGGA
CACGGCCCCAAACGCCAGCGCGGGCAGGGAGAGGATGGAGAACGACATCAAGACGGGTGGCGTCCAGCGGCGGGG
TGACCGCGACGATCCCAGCGCGGCCGTCTTTGGAGAGGCTTGGGAGGCCAAGAAGGAGCGGATTCGCAAGTCGTC
CCCCTACGGCTGGATGAAGAATTGGGACCTGGTCAGCGTCATTGTCAAGACGGGAGCCGACCTGCGGCAGGAGGC
CTTTGCTTGTCAGCTCATCGACGTCTGCCACCGGATCTGGGTCGACGCCGACGTCGATGTCTGGGTCAAGCTGAT
GCGCATCCTGGTGACGGGCGAGTCGTCGGGCCTAATCGAGACCATCACCAACGGCGTCTCGCTCCACTCGCTCAA
GCGGAGCCTGACGCTGGCGGCGGCCGACTCGGGCCAGGCGGCGCGACAGCGCATCGCCACGCTGCGCGACCATTT
CCTCAAGGCCTTTGGCCAGCCGGAGAGTGAGCCGTACAGAGCCGGCGTCGACGCATTCAAGCGCTCGCTAGCGGC
CTACAGCATCATCTCGTACATCCTGCAGCTCAAGGACCGGCACAACGGCAACGTGCTTATCGACAGCGAGGGCCA
CATTATTCACATCGACTTTGGCTTTATGCTGTCCAATTCGCCCGGCTCCGTCGGGTTCGAGGCGGCGCCTTTCAA
GCTCACGCACGAGTACGTCGACGTGCTGGGCGGCATCGGGTCCCCGGACTTTGAGGACTACAAGAGGCTGTGCAA
GCAGGCATTTCAAGGTGAGCTGGGAGATGCGTTGGAGAGGAAAGAGGCTAACGGAGAAGCAGCGCTGCGCCGATC
GGCGGACAACATCATTGATCTGGTCGCCATGATGGGCCGCGACTCCAGCATGCCGTGCTTCTCGGTGGGCGTAGC
TCACGCGACGAACAGCCTCCGACAGCGTTTCCAGCTACACCTCAGCGCCGTCGAGGCGGAGCAGTTTGTCGAGAC
GGATCTCGTGGGCAAGTCGTACGGGAGCTACTACACGCGACTGTAAGCCGGCCCCGTCCCCTGTTGCCGCCTGGC
GCTGACATGGCTTCGTAGGTATGACACGTTCCAGTATCGGACTCAGGGCATCTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail