Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8433
Gene name
Locationscaffold_94:13698..14320
Strand+
Gene length (bp)622
Transcript length (bp)567
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17254 DUF5321 Family of unknown function (DUF5321) 8.8E-51 33 175

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 72 91 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 46.97 20.46 73.49
CcL In ants, during behavior modification 51.64 22.64 80.63
CcD In ants, recently dead 74.14 35.29 113.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.778904 no
SC16a CcD 0.091893 no
CcL CcD 0.198272 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8433
MILSRCAIRARALIRKQSQFQLPVEQRFCRYSSAPATVVDVGFWKSLVPKAWRGERQNDELRPKSKGWNPATYFI
IMFLFIGSMSIQMIVLHKQSEQDARRSAVKIALLREIVEKIRKGEKVDVEKALGTGDAEREANWEEVLRQIERDE
TRRKPPKPSEAGEKAYEQGAAPETQPVRKRTAGIDGFF
Coding >Ophio5|8433
ATGATACTATCGAGATGCGCTATTCGGGCTAGAGCCCTGATTCGGAAGCAGTCGCAGTTTCAGCTACCCGTCGAA
CAGCGATTCTGCCGATACAGTAGCGCTCCGGCCACTGTCGTCGATGTCGGCTTCTGGAAGTCGCTGGTCCCCAAG
GCGTGGCGTGGGGAGAGACAGAATGACGAACTGCGACCCAAATCCAAGGGGTGGAACCCAGCGACGTATTTTATC
ATCATGTTTCTCTTCATCGGCTCCATGTCGATCCAGATGATTGTCCTGCACAAGCAAAGCGAGCAGGACGCGCGC
CGGTCGGCCGTCAAGATAGCGCTGTTACGGGAGATTGTCGAAAAGATACGTAAGGGGGAAAAGGTTGACGTCGAG
AAAGCGCTGGGCACGGGCGATGCCGAGAGAGAGGCCAACTGGGAAGAAGTGCTGCGACAGATTGAGCGCGACGAG
ACGCGGCGCAAGCCACCGAAGCCATCCGAGGCGGGCGAGAAAGCCTACGAGCAGGGCGCCGCACCTGAAACGCAG
CCCGTCAGGAAGAGGACGGCCGGTATTGACGGCTTTTTC
Transcript >Ophio5|8433
ATGATACTATCGAGATGCGCTATTCGGGCTAGAGCCCTGATTCGGAAGCAGTCGCAGTTTCAGCTACCCGTCGAA
CAGCGATTCTGCCGATACAGTAGCGCTCCGGCCACTGTCGTCGATGTCGGCTTCTGGAAGTCGCTGGTCCCCAAG
GCGTGGCGTGGGGAGAGACAGAATGACGAACTGCGACCCAAATCCAAGGGGTGGAACCCAGCGACGTATTTTATC
ATCATGTTTCTCTTCATCGGCTCCATGTCGATCCAGATGATTGTCCTGCACAAGCAAAGCGAGCAGGACGCGCGC
CGGTCGGCCGTCAAGATAGCGCTGTTACGGGAGATTGTCGAAAAGATACGTAAGGGGGAAAAGGTTGACGTCGAG
AAAGCGCTGGGCACGGGCGATGCCGAGAGAGAGGCCAACTGGGAAGAAGTGCTGCGACAGATTGAGCGCGACGAG
ACGCGGCGCAAGCCACCGAAGCCATCCGAGGCGGGCGAGAAAGCCTACGAGCAGGGCGCCGCACCTGAAACGCAG
CCCGTCAGGAAGAGGACGGCCGGTATTGACGGCTTTTTCTGA
Gene >Ophio5|8433
ATGATACTATCGAGATGCGCTATTCGGGCTAGAGCCCTGATTCGGAAGCAGTCGCAGTTTCAGCTACCCGTCGAA
CAGCGATTCTGCCGATACAGTAGCGCTCCGGCCACTGTCGTCGATGTCGGCTTCTGGAAGTCGCTGGTCCCCAAG
GCGTGGCGTGGGGAGAGACAGAATGACGAACTGCGACCCAAATCCAAGGGGTGGAACCCAGCGACGTATTTTATC
ATCATGTTTCTCTTCATCGGCTCCATGTCGATCCAGATGATTGTCCTGCACAAGCAAAGCGAGCAGGACGCGCGC
CGGTCGGCCGTCAAGATAGCGCTGTTACGGGAGATTGTCGAAAAGATACGTAAGGGGGAAAAGGTTGACGTCGAG
AAAGCGCTGGGCACGGGCGATGCCGAGAGAGAGGCCAACTGGGAAGAAGGTAAGTTGCCACGAAGGGGAAACGGT
CGGCCTCCCTCACTAAGAGGGGTCGACAGTGCTGCGACAGATTGAGCGCGACGAGACGCGGCGCAAGCCACCGAA
GCCATCCGAGGCGGGCGAGAAAGCCTACGAGCAGGGCGCCGCACCTGAAACGCAGCCCGTCAGGAAGAGGACGGC
CGGTATTGACGGCTTTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail