Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8427
Gene name
Locationscaffold_934:3983..4650
Strand+
Gene length (bp)667
Transcript length (bp)576
Coding sequence length (bp)573
Protein length (aa) 191

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04145 Ctr Ctr copper transporter family 1.2E-34 28 181

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005375 copper ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0035434 copper ion transmembrane transport Yes
GO:0000041 transition metal ion transport No
GO:0008150 biological_process No
GO:0098655 cation transmembrane transport No
GO:0031224 intrinsic component of membrane No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0098662 inorganic cation transmembrane transport No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0034220 ion transmembrane transport No
GO:0005215 transporter activity No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006825 copper ion transport No
GO:0030001 metal ion transport No
GO:0005575 cellular_component No
GO:0046873 metal ion transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0006812 cation transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1301 0.166 0.025 0.1483 0.044 0.004 0.4472 0.4678 0.2613 0.0133

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 155 177 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 856.36 408.94 1303.78
CcL In ants, during behavior modification 138.01 51.67 224.35
CcD In ants, recently dead 47.76 20.32 75.20

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Orthologs

Orthofinder run ID4
Orthogroup5912
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2842
Ophiocordyceps australis map64 (Brazil) OphauB2|5729
Ophiocordyceps camponoti-floridani Ophcf2|03453
Ophiocordyceps camponoti-rufipedis Ophun1|6605
Ophiocordyceps kimflemingae Ophio5|8427 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8427
MPSLEPRHQGHDDAAMAEGSMGAMMMSMVFQNNIQTPLYANSWTPRSAGAYAGTCIFLVILAIVARLLLAARGFQ
EARWQDGDARRRYVASPAKSSLADRLAASPDAKQMTLSENGVEENVVVVARSGSPPRPWRFSVDPLRALFDTVIA
GVGYLLMLAVMTMNLGYFLSVLAGVFVGSLAVGRFSTWAEH
Coding >Ophio5|8427
ATGCCTTCTCTCGAACCACGTCACCAAGGCCACGACGACGCGGCCATGGCCGAAGGCTCAATGGGCGCCATGATG
ATGTCCATGGTTTTCCAGAACAACATCCAGACGCCGCTGTACGCCAACTCGTGGACACCACGCAGCGCCGGTGCC
TACGCCGGAACCTGCATCTTCCTCGTCATTCTCGCCATCGTCGCTCGCCTGCTCCTCGCCGCCCGCGGATTTCAG
GAGGCTAGGTGGCAGGATGGCGACGCGAGACGTCGCTATGTCGCTTCGCCCGCCAAGTCGTCGCTCGCAGACCGC
TTGGCCGCCTCGCCGGATGCCAAGCAGATGACGCTCTCGGAGAATGGCGTCGAGGAGAATGTCGTCGTCGTTGCC
CGGAGTGGTTCTCCTCCGAGGCCGTGGCGCTTTAGTGTTGATCCTCTGCGGGCTTTGTTTGATACCGTCATTGCT
GGCGTCGGGTACCTTCTCATGTTGGCCGTCATGACCATGAACCTCGGCTACTTCTTGTCCGTTCTGGCCGGCGTC
TTCGTCGGCAGTCTCGCCGTCGGCCGCTTCAGCACCTGGGCCGAGCAC
Transcript >Ophio5|8427
ATGCCTTCTCTCGAACCACGTCACCAAGGCCACGACGACGCGGCCATGGCCGAAGGCTCAATGGGCGCCATGATG
ATGTCCATGGTTTTCCAGAACAACATCCAGACGCCGCTGTACGCCAACTCGTGGACACCACGCAGCGCCGGTGCC
TACGCCGGAACCTGCATCTTCCTCGTCATTCTCGCCATCGTCGCTCGCCTGCTCCTCGCCGCCCGCGGATTTCAG
GAGGCTAGGTGGCAGGATGGCGACGCGAGACGTCGCTATGTCGCTTCGCCCGCCAAGTCGTCGCTCGCAGACCGC
TTGGCCGCCTCGCCGGATGCCAAGCAGATGACGCTCTCGGAGAATGGCGTCGAGGAGAATGTCGTCGTCGTTGCC
CGGAGTGGTTCTCCTCCGAGGCCGTGGCGCTTTAGTGTTGATCCTCTGCGGGCTTTGTTTGATACCGTCATTGCT
GGCGTCGGGTACCTTCTCATGTTGGCCGTCATGACCATGAACCTCGGCTACTTCTTGTCCGTTCTGGCCGGCGTC
TTCGTCGGCAGTCTCGCCGTCGGCCGCTTCAGCACCTGGGCCGAGCACTAA
Gene >Ophio5|8427
ATGCCTTCTCTCGAACCACGTCACCAAGGCCACGACGACGCGGCCATGGCCGAAGGCTCAATGGGCGCCATGATG
ATGTCCATGGTTTTCCAGAACAACATCCAGACGCCGCTGTACGCCAACTCGTGGACACCACGCAGCGCCGGTGCC
TACGCCGGAACCTGCATCTTCCTCGTCATTCTCGCCATCGTCGCTCGCCTGCTCCTCGCCGCCCGCGGATTTCAG
GAGGCTAGGTGGCAGGATGGCGACGCGAGACGTCGCTATGTCGCTTCGCCCGCCAAGTCGTCGCTCGCAGACCGC
TTGGCCGCCTCGCCGGATGCCAAGCAGATGACGCTCTCGGAGAATGGCGTCGAGGAGAATGTCGTCGTCGTTGCC
CGGAGTGGTTCTCCTCCGAGGCCGTGGCGCTTTAGTGTTGATCCTCTGCGGGCTTTGTTTGATACCGTCATTGCT
GGCGTCGGGTACCTTCTGTGAGTTGCCCTCTTCTTTCTCTCACTTTCTCTCTTTTTCTCTCTCCATATATATATA
CATACATATGTTCCGAGGCTAACGGAATTGTAGCATGTTGGCCGTCATGACCATGAACCTCGGCTACTTCTTGTC
CGTTCTGGCCGGCGTCTTCGTCGGCAGTCTCGCCGTCGGCCGCTTCAGCACCTGGGCCGAGCACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail