Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8404
Gene name
Locationscaffold_93:21680..22740
Strand-
Gene length (bp)1060
Transcript length (bp)930
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 1.5E-19 10 283

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 188 210 22
3 217 239 22
4 268 290 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8404
MAAVNRFLVLLPVTLALVSFVLTSLTLFAGHKPGFMEDSAVIRINTSHIGHNLLDKRDDNRPAILSDLQGWINDK
KGDIEDNIRGKINQGVGRLADKVVGKLHLSHWYSMHIMDSCQGSFTPNLTTPDAELKTTSCTTSDPTHRLNLTRL
VDGQLNLGPLNLSLADIGWPDSVQDKIDALNDALTGLFVVYVLAMGCSGLSMLAGLGAFFLPGLGALTLVNLVVA
SLGGLSCFVGSIIVAATASKAVKHINDRGARFGISAERGVKFYTMGWVATGFMFAVTVYWLGQFFAMRRSHAAKL
QEKQLQQEP
Coding >Ophio5|8404
ATGGCTGCCGTCAACAGATTCCTCGTCTTGCTGCCCGTCACCCTCGCCCTCGTCAGCTTCGTCCTCACCTCGCTC
ACCCTCTTCGCCGGCCACAAGCCGGGCTTCATGGAGGACTCTGCCGTCATCAGGATCAACACCTCTCACATCGGC
CACAATCTCTTGGACAAGCGCGACGACAACCGGCCCGCCATTCTCAGTGACCTCCAGGGCTGGATCAACGACAAG
AAGGGCGATATCGAGGATAACATCAGGGGAAAGATCAATCAAGGCGTCGGCCGTCTCGCTGACAAGGTCGTCGGC
AAGCTGCACCTCTCCCACTGGTATTCCATGCACATCATGGACTCGTGCCAGGGCAGCTTCACGCCCAACTTGACC
ACCCCCGACGCCGAGCTCAAGACGACCAGCTGCACCACGTCCGATCCGACCCATCGTCTCAACCTGACGCGCCTC
GTCGATGGTCAGCTCAATCTCGGCCCCCTCAACCTCAGCCTCGCCGACATCGGCTGGCCCGACAGCGTCCAGGAC
AAGATCGACGCGCTCAACGACGCCTTGACGGGCCTCTTCGTCGTCTACGTCCTGGCCATGGGCTGCAGCGGCCTC
TCCATGCTCGCCGGCCTCGGCGCCTTCTTCCTGCCCGGCCTGGGCGCCCTGACGCTGGTCAACCTGGTGGTGGCC
TCGCTGGGCGGGCTGTCGTGCTTCGTCGGCAGCATCATCGTCGCCGCCACCGCCTCCAAGGCCGTCAAGCACATC
AATGACAGGGGCGCACGCTTCGGCATCTCCGCCGAGCGGGGCGTCAAGTTTTACACCATGGGCTGGGTGGCCACG
GGCTTCATGTTTGCCGTCACCGTCTATTGGCTCGGCCAGTTCTTTGCCATGAGGCGCAGTCACGCTGCCAAGCTA
CAGGAGAAGCAGCTGCAGCAGGAGCCG
Transcript >Ophio5|8404
ATGGCTGCCGTCAACAGATTCCTCGTCTTGCTGCCCGTCACCCTCGCCCTCGTCAGCTTCGTCCTCACCTCGCTC
ACCCTCTTCGCCGGCCACAAGCCGGGCTTCATGGAGGACTCTGCCGTCATCAGGATCAACACCTCTCACATCGGC
CACAATCTCTTGGACAAGCGCGACGACAACCGGCCCGCCATTCTCAGTGACCTCCAGGGCTGGATCAACGACAAG
AAGGGCGATATCGAGGATAACATCAGGGGAAAGATCAATCAAGGCGTCGGCCGTCTCGCTGACAAGGTCGTCGGC
AAGCTGCACCTCTCCCACTGGTATTCCATGCACATCATGGACTCGTGCCAGGGCAGCTTCACGCCCAACTTGACC
ACCCCCGACGCCGAGCTCAAGACGACCAGCTGCACCACGTCCGATCCGACCCATCGTCTCAACCTGACGCGCCTC
GTCGATGGTCAGCTCAATCTCGGCCCCCTCAACCTCAGCCTCGCCGACATCGGCTGGCCCGACAGCGTCCAGGAC
AAGATCGACGCGCTCAACGACGCCTTGACGGGCCTCTTCGTCGTCTACGTCCTGGCCATGGGCTGCAGCGGCCTC
TCCATGCTCGCCGGCCTCGGCGCCTTCTTCCTGCCCGGCCTGGGCGCCCTGACGCTGGTCAACCTGGTGGTGGCC
TCGCTGGGCGGGCTGTCGTGCTTCGTCGGCAGCATCATCGTCGCCGCCACCGCCTCCAAGGCCGTCAAGCACATC
AATGACAGGGGCGCACGCTTCGGCATCTCCGCCGAGCGGGGCGTCAAGTTTTACACCATGGGCTGGGTGGCCACG
GGCTTCATGTTTGCCGTCACCGTCTATTGGCTCGGCCAGTTCTTTGCCATGAGGCGCAGTCACGCTGCCAAGCTA
CAGGAGAAGCAGCTGCAGCAGGAGCCGTGA
Gene >Ophio5|8404
ATGGCTGCCGTCAACAGATTCCTCGTCTTGCTGCCCGTCACCCTCGCCCTCGTCAGCTTCGTCCTCACCTCGCTC
ACCCTCTTCGCCGGCCACAAGCCGGGCTTCATGGAGGACTCTGCCGTCATCAGGGTAAGCAGCCCTGCATGGTGT
TGCCTTACACTTGCTAAACCTAACCCTAAACAACAGATCAACACCTCTCACATCGGCCACAATCTCTTGGACAAG
CGCGACGACAACCGGCCCGCCATTCTCAGTGACCTCCAGGGCTGGATCAACGACAAGAAGGGCGATATCGAGGAT
AACATCAGGGGAAAGATCAATCAAGGCGTCGGCCGTCTCGCTGACAAGGTCGTCGGCAAGCTGCACCTCTCCCAC
TGGTATTCCATGCACATCATGGACTCGTGCCAGGGCAGCTTCACGCCCAACTTGACCACCCCCGACGCCGAGCTC
AAGACGACCAGCTGCACCACGTCCGATCCGACCCGTAAGGATCCCCCTCCCTTTACCGAAAATACGACATACCCT
TGCGTCGCTGACCTTTTTTTTGTCCTTTGCAGATCGTCTCAACCTGACGCGCCTCGTCGATGGTCAGCTCAATCT
CGGCCCCCTCAACCTCAGCCTCGCCGACATCGGCTGGCCCGACAGCGTCCAGGACAAGATCGACGCGCTCAACGA
CGCCTTGACGGGCCTCTTCGTCGTCTACGTCCTGGCCATGGGCTGCAGCGGCCTCTCCATGCTCGCCGGCCTCGG
CGCCTTCTTCCTGCCCGGCCTGGGCGCCCTGACGCTGGTCAACCTGGTGGTGGCCTCGCTGGGCGGGCTGTCGTG
CTTCGTCGGCAGCATCATCGTCGCCGCCACCGCCTCCAAGGCCGTCAAGCACATCAATGACAGGGGCGCACGCTT
CGGCATCTCCGCCGAGCGGGGCGTCAAGTTTTACACCATGGGCTGGGTGGCCACGGGCTTCATGTTTGCCGTCAC
CGTCTATTGGCTCGGCCAGTTCTTTGCCATGAGGCGCAGTCACGCTGCCAAGCTACAGGAGAAGCAGCTGCAGCA
GGAGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail