Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8389
Gene name
Locationscaffold_924:2855..4079
Strand+
Gene length (bp)1224
Transcript length (bp)1224
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 289 311 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 78.51 42.90 114.11
CcL In ants, during behavior modification 67.98 36.56 99.40
CcD In ants, recently dead 60.00 32.43 87.56

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.569817 no
SC16a CcD 0.252824 no
CcL CcD 0.637182 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8389
MGKPTTSFASASLPQPASARLDESGSAISLHTSSGRYRDDPEANDDDDDDDQDLPPLYTEHEEYSDTVVDPLVPP
GTGPLVTPFGHDGDGATAYYLDRRLDSDPVFLADHVRRLATIPPRPWVRLRGTHRERRRRAGGDKSHLSGDDVVV
DFDIRIELTHLLYSDIRRQQAWRALVTAGNLEKVRRGTVFPDRAPGFGGAPCSAGGAVEQNGVPGLDQWCHRFCA
SPAHLRCFSVERRIVGWDWDLLRRRLEALIRATNYRGHAVVSFPVGNARADMYSNCRTNRWRLTGWIRFVFYATL
LFLFTWPWLFFRTRRWETVAAEWYVSMPTSVPGRRQYAAGVSEERWYALWAPAIQRAMLERRDGQLDQGDLERAQ
GQTTTGQGVVRAGVEAAMGVVNRSFGWGGDEC
Coding >Ophio5|8389
ATGGGCAAACCGACTACATCCTTTGCATCCGCCTCCTTGCCGCAGCCGGCTTCCGCCCGCCTCGATGAATCCGGC
AGCGCTATTTCCCTCCACACGTCTTCGGGCCGCTATCGCGATGATCCCGAGGCCAATGACGACGACGACGACGAC
GATCAAGACCTCCCGCCGCTGTACACCGAACACGAAGAGTACAGCGATACGGTTGTCGATCCTCTCGTCCCTCCC
GGCACCGGCCCTCTCGTGACGCCCTTTGGCCACGACGGCGACGGCGCAACAGCCTACTATCTCGACCGTCGTCTC
GACTCCGATCCCGTCTTCCTCGCCGATCATGTGCGTCGTCTTGCTACTATACCGCCCCGACCATGGGTGCGGCTT
CGAGGAACTCATCGTGAGCGGCGTCGTCGGGCCGGTGGTGATAAGAGTCATCTCTCTGGCGACGACGTGGTTGTC
GACTTTGACATTCGCATCGAGTTGACCCATCTCCTTTACTCTGATATCCGGCGACAACAGGCCTGGCGCGCCCTC
GTCACCGCCGGAAACCTGGAAAAAGTCCGTCGAGGAACCGTCTTTCCCGATCGAGCTCCGGGTTTCGGCGGCGCT
CCTTGTTCGGCCGGCGGCGCGGTGGAGCAGAACGGCGTACCTGGCCTCGACCAATGGTGTCATCGCTTCTGTGCC
AGCCCTGCTCACCTACGCTGCTTTAGCGTGGAGCGCCGCATCGTCGGCTGGGACTGGGATCTGCTTCGACGACGG
CTCGAGGCCCTAATCCGCGCAACTAATTACCGCGGCCATGCTGTCGTCAGCTTTCCCGTCGGCAATGCCCGCGCC
GACATGTACAGCAACTGCCGCACCAACCGTTGGCGCCTGACGGGTTGGATCCGCTTCGTCTTCTACGCCACCCTG
CTCTTCCTCTTTACCTGGCCCTGGCTCTTCTTCCGTACCCGCCGATGGGAAACGGTGGCGGCTGAGTGGTACGTC
AGCATGCCGACCAGCGTTCCCGGTCGCAGGCAGTATGCGGCCGGCGTCAGCGAGGAGCGCTGGTATGCCTTGTGG
GCGCCTGCCATTCAGCGCGCCATGCTCGAGCGCAGGGACGGTCAGCTGGATCAGGGTGACCTGGAGCGGGCTCAG
GGACAGACGACCACTGGTCAGGGTGTTGTCAGGGCGGGCGTCGAGGCGGCCATGGGCGTCGTCAATCGGTCTTTT
GGATGGGGGGGTGATGAGTGT
Transcript >Ophio5|8389
ATGGGCAAACCGACTACATCCTTTGCATCCGCCTCCTTGCCGCAGCCGGCTTCCGCCCGCCTCGATGAATCCGGC
AGCGCTATTTCCCTCCACACGTCTTCGGGCCGCTATCGCGATGATCCCGAGGCCAATGACGACGACGACGACGAC
GATCAAGACCTCCCGCCGCTGTACACCGAACACGAAGAGTACAGCGATACGGTTGTCGATCCTCTCGTCCCTCCC
GGCACCGGCCCTCTCGTGACGCCCTTTGGCCACGACGGCGACGGCGCAACAGCCTACTATCTCGACCGTCGTCTC
GACTCCGATCCCGTCTTCCTCGCCGATCATGTGCGTCGTCTTGCTACTATACCGCCCCGACCATGGGTGCGGCTT
CGAGGAACTCATCGTGAGCGGCGTCGTCGGGCCGGTGGTGATAAGAGTCATCTCTCTGGCGACGACGTGGTTGTC
GACTTTGACATTCGCATCGAGTTGACCCATCTCCTTTACTCTGATATCCGGCGACAACAGGCCTGGCGCGCCCTC
GTCACCGCCGGAAACCTGGAAAAAGTCCGTCGAGGAACCGTCTTTCCCGATCGAGCTCCGGGTTTCGGCGGCGCT
CCTTGTTCGGCCGGCGGCGCGGTGGAGCAGAACGGCGTACCTGGCCTCGACCAATGGTGTCATCGCTTCTGTGCC
AGCCCTGCTCACCTACGCTGCTTTAGCGTGGAGCGCCGCATCGTCGGCTGGGACTGGGATCTGCTTCGACGACGG
CTCGAGGCCCTAATCCGCGCAACTAATTACCGCGGCCATGCTGTCGTCAGCTTTCCCGTCGGCAATGCCCGCGCC
GACATGTACAGCAACTGCCGCACCAACCGTTGGCGCCTGACGGGTTGGATCCGCTTCGTCTTCTACGCCACCCTG
CTCTTCCTCTTTACCTGGCCCTGGCTCTTCTTCCGTACCCGCCGATGGGAAACGGTGGCGGCTGAGTGGTACGTC
AGCATGCCGACCAGCGTTCCCGGTCGCAGGCAGTATGCGGCCGGCGTCAGCGAGGAGCGCTGGTATGCCTTGTGG
GCGCCTGCCATTCAGCGCGCCATGCTCGAGCGCAGGGACGGTCAGCTGGATCAGGGTGACCTGGAGCGGGCTCAG
GGACAGACGACCACTGGTCAGGGTGTTGTCAGGGCGGGCGTCGAGGCGGCCATGGGCGTCGTCAATCGGTCTTTT
GGATGGGGGGGTGATGAGTGTTGA
Gene >Ophio5|8389
ATGGGCAAACCGACTACATCCTTTGCATCCGCCTCCTTGCCGCAGCCGGCTTCCGCCCGCCTCGATGAATCCGGC
AGCGCTATTTCCCTCCACACGTCTTCGGGCCGCTATCGCGATGATCCCGAGGCCAATGACGACGACGACGACGAC
GATCAAGACCTCCCGCCGCTGTACACCGAACACGAAGAGTACAGCGATACGGTTGTCGATCCTCTCGTCCCTCCC
GGCACCGGCCCTCTCGTGACGCCCTTTGGCCACGACGGCGACGGCGCAACAGCCTACTATCTCGACCGTCGTCTC
GACTCCGATCCCGTCTTCCTCGCCGATCATGTGCGTCGTCTTGCTACTATACCGCCCCGACCATGGGTGCGGCTT
CGAGGAACTCATCGTGAGCGGCGTCGTCGGGCCGGTGGTGATAAGAGTCATCTCTCTGGCGACGACGTGGTTGTC
GACTTTGACATTCGCATCGAGTTGACCCATCTCCTTTACTCTGATATCCGGCGACAACAGGCCTGGCGCGCCCTC
GTCACCGCCGGAAACCTGGAAAAAGTCCGTCGAGGAACCGTCTTTCCCGATCGAGCTCCGGGTTTCGGCGGCGCT
CCTTGTTCGGCCGGCGGCGCGGTGGAGCAGAACGGCGTACCTGGCCTCGACCAATGGTGTCATCGCTTCTGTGCC
AGCCCTGCTCACCTACGCTGCTTTAGCGTGGAGCGCCGCATCGTCGGCTGGGACTGGGATCTGCTTCGACGACGG
CTCGAGGCCCTAATCCGCGCAACTAATTACCGCGGCCATGCTGTCGTCAGCTTTCCCGTCGGCAATGCCCGCGCC
GACATGTACAGCAACTGCCGCACCAACCGTTGGCGCCTGACGGGTTGGATCCGCTTCGTCTTCTACGCCACCCTG
CTCTTCCTCTTTACCTGGCCCTGGCTCTTCTTCCGTACCCGCCGATGGGAAACGGTGGCGGCTGAGTGGTACGTC
AGCATGCCGACCAGCGTTCCCGGTCGCAGGCAGTATGCGGCCGGCGTCAGCGAGGAGCGCTGGTATGCCTTGTGG
GCGCCTGCCATTCAGCGCGCCATGCTCGAGCGCAGGGACGGTCAGCTGGATCAGGGTGACCTGGAGCGGGCTCAG
GGACAGACGACCACTGGTCAGGGTGTTGTCAGGGCGGGCGTCGAGGCGGCCATGGGCGTCGTCAATCGGTCTTTT
GGATGGGGGGGTGATGAGTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail