Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8387
Gene name
Locationscaffold_924:40..996
Strand-
Gene length (bp)956
Transcript length (bp)651
Coding sequence length (bp)648
Protein length (aa) 216

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6402 0.4938 0.0975 0.0988 0.2316 0.0282 0.1412 0.1653 0.1759 0.0087

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6887
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03537
Ophiocordyceps camponoti-rufipedis Ophun1|3638
Ophiocordyceps camponoti-rufipedis Ophun1|5008
Ophiocordyceps kimflemingae Ophio5|8387 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8387
MDSTARFSTDEYPTTVRLEQPIKSLRDSYQKRSSLPQSYDIFFNEAPAAAVVVDDGMSCEQLVKIVNKHCHSITA
LRVNFRIAHGIKDGTWSSVGLLLGGHGGVDGLIPLAKEARPGFQVDNLDVDLKLVFESDVVPLRDIQLIRLLDIP
GNRYYGPDSWVFGGITLTATCADFPEKMEMLKYATVNKEMKRETGRFDMETVWEGDVELKDWNRQP
Coding >Ophio5|8387
ATGGATTCGACAGCCCGATTCTCTACAGATGAATATCCTACGACAGTTCGACTGGAACAACCCATCAAGTCCTTA
CGAGACTCGTACCAAAAACGAAGCTCACTTCCACAAAGCTACGACATCTTCTTCAATGAAGCACCCGCCGCCGCC
GTCGTCGTCGATGACGGGATGAGCTGTGAACAACTAGTCAAAATCGTCAACAAGCATTGCCATTCCATCACGGCG
CTACGAGTCAACTTTCGCATCGCCCATGGGATCAAGGACGGCACTTGGTCCTCTGTCGGTTTGTTGCTCGGCGGA
CATGGTGGTGTCGACGGTTTGATTCCTCTCGCAAAGGAAGCTCGGCCCGGTTTTCAGGTTGACAATCTCGACGTC
GATCTTAAGCTCGTCTTTGAATCGGATGTTGTCCCTTTGCGGGATATTCAGCTCATCAGGTTGCTTGATATACCA
GGGAATCGATATTATGGTCCAGATTCGTGGGTGTTTGGAGGCATCACTCTTACCGCCACCTGCGCCGACTTCCCC
GAAAAGATGGAAATGCTGAAATATGCAACCGTCAACAAGGAAATGAAGCGAGAAACGGGCCGTTTCGACATGGAG
ACGGTCTGGGAGGGCGACGTTGAGCTGAAGGATTGGAACCGTCAGCCG
Transcript >Ophio5|8387
ATGGATTCGACAGCCCGATTCTCTACAGATGAATATCCTACGACAGTTCGACTGGAACAACCCATCAAGTCCTTA
CGAGACTCGTACCAAAAACGAAGCTCACTTCCACAAAGCTACGACATCTTCTTCAATGAAGCACCCGCCGCCGCC
GTCGTCGTCGATGACGGGATGAGCTGTGAACAACTAGTCAAAATCGTCAACAAGCATTGCCATTCCATCACGGCG
CTACGAGTCAACTTTCGCATCGCCCATGGGATCAAGGACGGCACTTGGTCCTCTGTCGGTTTGTTGCTCGGCGGA
CATGGTGGTGTCGACGGTTTGATTCCTCTCGCAAAGGAAGCTCGGCCCGGTTTTCAGGTTGACAATCTCGACGTC
GATCTTAAGCTCGTCTTTGAATCGGATGTTGTCCCTTTGCGGGATATTCAGCTCATCAGGTTGCTTGATATACCA
GGGAATCGATATTATGGTCCAGATTCGTGGGTGTTTGGAGGCATCACTCTTACCGCCACCTGCGCCGACTTCCCC
GAAAAGATGGAAATGCTGAAATATGCAACCGTCAACAAGGAAATGAAGCGAGAAACGGGCCGTTTCGACATGGAG
ACGGTCTGGGAGGGCGACGTTGAGCTGAAGGATTGGAACCGTCAGCCGTAG
Gene >Ophio5|8387
ATGGATTCGACAGCGTACGTTGCTTCGTCTTCTTCTTTCCCCCTGAAAGGAAATTGACGGGAGCGCCACAGCCGA
TTCTCTACAGATGAATATCCTACGACAGTTCGACTGGAACAACGTCGACGTCCCCGAATTCATCCGACGCGCCAT
GTTAGCAACAGCAGTCCTGACGCCAATGCTATGCCGCGCAGCCATCAAGTCCTTACGAGACTCGTACCAAAAACG
AAGCTCACTTCCACAAAGCTACGACATCTTCTTCAATGAAGCACCCGCCGCCGCCGTCGTCGTCGATGACGGGAT
GAGCTGTGAACAACTAGTCAAAATCGTCAACAAGCATTGCCATTCCATCACGGCGCTACGAGTCAACTTTCGCAT
CGCCCATGGGATCAAGGACGGCACTTGGTCCTCTGTCGGTTTGTTGCTCGGCGGACATGGTGGTGTCGACGGTTT
GATTCCTCTCGCAAAGGAAGCTCGGCCCGGTTTTCAGGTTGACAATCTCGACGTCGATCTTAAGCTCGTCTTTGA
ATCGGATGTTGTCCCTTTGCGGGATATTCAGCTCATCAGGTTGCTTGATATACCAGGGAATCGATATTATGGTCC
AGATTCGTGGGTGTTTGGAGGTGAGATGCTTTTCTGCCGTGCTGAAAAACTCCTTTCTGGAACCCCCACCCCCCC
CTTTTTTTTTTCTCTCTCTGTCTCTTTTCCCCTGTCACCGTCTCTTTCACGTTCTCTATCTCTCTCTCTCTCTCT
CTCTCTCTATCTTTCTCTCTCTCTCTCTAAAAGTTGATAATTTAGGCATCACTCTTACCGCCACCTGCGCCGACT
TCCCCGAAAAGATGGAAATGCTGAAATATGCAACCGTCAACAAGGAAATGAAGCGAGAAACGGGCCGTTTCGACA
TGGAGACGGTCTGGGAGGGCGACGTTGAGCTGAAGGATTGGAACCGTCAGCCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail