Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8383
Gene name
Locationscaffold_921:4368..5598
Strand-
Gene length (bp)1230
Transcript length (bp)1176
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 6 362 2.0E-24
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 7 333 7.0E-13
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 7 337 1.0E-11
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 7 333 5.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 161 178 17
3 213 235 22
4 242 264 22
5 274 296 22
6 317 339 22
7 343 360 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8383
MAGHRSIIGPIIGGALARPCISYPDLFPRGTIWDRYPYLLPNLFSAAAVLVGVVIGLLFLDETHSAKKLQRDHGR
ELGQRLVALFRRAAVCKCRGRAVEKQSLLVPDSPKRGAYGACSRDNLPDLDEPLPAYESRESSPKLAPATNEPQP
SPKSTIFTKPVIMNIISYGILAFHTMTFDQLFPVFLSTSPLQHPVRELPFKFADGFGLDTKSIGVVMSIQGVYSL
LSNYIIVPPVTRRLGSLRLFRMLAFSYFALYLVTPYLVLLPTNLRMPAVYALVIWKCTYATMAYPNNAILLANAA
PSKQVLGTINGVAASTASLCRALGPTLSGVLYAVGLRTGYSGLAWWFSGLVTVVGAYLSSRITEGETQTVPTEEE
EALLEDALLYSEDEAV
Coding >Ophio5|8383
ATGGCTGGACACAGATCCATCATCGGCCCCATCATCGGAGGCGCATTGGCCCGCCCGTGCATCAGCTATCCGGAC
CTGTTCCCGCGTGGCACCATCTGGGATCGTTACCCTTACCTGCTGCCCAACTTGTTCAGCGCCGCCGCCGTCCTG
GTTGGCGTCGTCATCGGCCTCTTGTTTCTCGATGAGACGCATTCCGCCAAGAAGCTGCAGAGGGACCATGGCCGC
GAGCTCGGCCAGCGCCTCGTTGCTCTTTTCCGCCGCGCAGCCGTCTGCAAGTGCCGCGGACGAGCTGTCGAGAAG
CAGAGCCTGCTCGTGCCCGACAGTCCGAAGAGGGGAGCATACGGCGCATGTAGCCGCGATAACCTTCCGGACTTG
GACGAGCCGCTGCCTGCCTATGAGAGCCGGGAGAGCTCACCCAAGCTCGCGCCGGCGACGAATGAACCGCAGCCC
AGCCCAAAGAGCACCATCTTTACCAAGCCTGTTATCATGAACATCATATCCTATGGCATCCTGGCCTTCCACACC
ATGACTTTTGATCAGCTCTTCCCCGTCTTCCTCAGCACCTCGCCGCTTCAGCACCCAGTGCGCGAGTTGCCCTTC
AAGTTCGCGGATGGCTTCGGCCTCGACACCAAGTCCATCGGCGTCGTCATGTCTATCCAGGGCGTCTACTCGCTC
CTCTCCAACTACATCATCGTTCCCCCCGTCACTCGACGCCTCGGCTCCCTTCGGCTCTTCCGCATGCTCGCCTTC
TCCTACTTTGCCCTCTACCTCGTCACGCCGTACCTAGTACTGCTCCCGACGAACCTACGGATGCCGGCCGTCTAC
GCCCTCGTAATCTGGAAGTGCACCTACGCGACAATGGCGTACCCGAACAATGCTATCCTACTGGCCAACGCGGCA
CCCAGCAAACAGGTGCTCGGCACCATCAACGGCGTGGCCGCGTCGACGGCGAGCCTGTGCCGCGCTCTGGGGCCC
ACGCTCTCGGGTGTTCTGTACGCGGTTGGCTTGAGGACGGGGTACTCGGGCCTCGCATGGTGGTTCAGCGGGCTG
GTCACCGTCGTTGGCGCCTACTTGAGCTCGCGAATTACCGAGGGCGAGACGCAAACCGTTCCGACAGAAGAGGAG
GAGGCGCTGTTGGAGGATGCGCTCCTCTACAGCGAGGACGAGGCCGTA
Transcript >Ophio5|8383
ATGGCTGGACACAGATCCATCATCGGCCCCATCATCGGAGGCGCATTGGCCCGCCCGTGCATCAGCTATCCGGAC
CTGTTCCCGCGTGGCACCATCTGGGATCGTTACCCTTACCTGCTGCCCAACTTGTTCAGCGCCGCCGCCGTCCTG
GTTGGCGTCGTCATCGGCCTCTTGTTTCTCGATGAGACGCATTCCGCCAAGAAGCTGCAGAGGGACCATGGCCGC
GAGCTCGGCCAGCGCCTCGTTGCTCTTTTCCGCCGCGCAGCCGTCTGCAAGTGCCGCGGACGAGCTGTCGAGAAG
CAGAGCCTGCTCGTGCCCGACAGTCCGAAGAGGGGAGCATACGGCGCATGTAGCCGCGATAACCTTCCGGACTTG
GACGAGCCGCTGCCTGCCTATGAGAGCCGGGAGAGCTCACCCAAGCTCGCGCCGGCGACGAATGAACCGCAGCCC
AGCCCAAAGAGCACCATCTTTACCAAGCCTGTTATCATGAACATCATATCCTATGGCATCCTGGCCTTCCACACC
ATGACTTTTGATCAGCTCTTCCCCGTCTTCCTCAGCACCTCGCCGCTTCAGCACCCAGTGCGCGAGTTGCCCTTC
AAGTTCGCGGATGGCTTCGGCCTCGACACCAAGTCCATCGGCGTCGTCATGTCTATCCAGGGCGTCTACTCGCTC
CTCTCCAACTACATCATCGTTCCCCCCGTCACTCGACGCCTCGGCTCCCTTCGGCTCTTCCGCATGCTCGCCTTC
TCCTACTTTGCCCTCTACCTCGTCACGCCGTACCTAGTACTGCTCCCGACGAACCTACGGATGCCGGCCGTCTAC
GCCCTCGTAATCTGGAAGTGCACCTACGCGACAATGGCGTACCCGAACAATGCTATCCTACTGGCCAACGCGGCA
CCCAGCAAACAGGTGCTCGGCACCATCAACGGCGTGGCCGCGTCGACGGCGAGCCTGTGCCGCGCTCTGGGGCCC
ACGCTCTCGGGTGTTCTGTACGCGGTTGGCTTGAGGACGGGGTACTCGGGCCTCGCATGGTGGTTCAGCGGGCTG
GTCACCGTCGTTGGCGCCTACTTGAGCTCGCGAATTACCGAGGGCGAGACGCAAACCGTTCCGACAGAAGAGGAG
GAGGCGCTGTTGGAGGATGCGCTCCTCTACAGCGAGGACGAGGCCGTATGA
Gene >Ophio5|8383
ATGGCTGGACACAGATCCATCATCGGCCCCATCATCGGAGGCGCATTGGCCCGCCCGTGCATCAGCTATCCGGAC
CTGTTCCCGCGTGGCACCATCTGGGATCGTTACCCTTACCTGCTGCCCAACTTGTTCAGCGCCGCCGCCGTCCTG
GTTGGCGTCGTCATCGGCCTCTTGTTTCTCGATGAGACGCATTCCGCCAAGAAGCTGCAGAGGGACCATGGCCGC
GAGCTCGGCCAGCGCCTCGTTGCTCTTTTCCGCCGCGCAGCCGTCTGCAAGTGCCGCGGACGAGCTGTCGAGAAG
CAGAGCCTGCTCGTGCCCGACAGTCCGAAGAGGGGAGCATACGGCGCATGTAGCCGCGATAACCTTCCGGACTTG
GACGAGCCGCTGCCTGCCTATGAGAGCCGGGAGAGCTCACCCAAGCTCGCGCCGGCGACGAATGAACCGCAGCCC
AGCCCAAAGAGCACCATCTTTACCAAGCCTGTTATCATGAACATCATATCCTATGGCATCCTGGCCTTGTAGGTG
CAATCCGCCCGAGCCCCTGGTTCTGTTGTCTCTAACACGAGAACTAGCCACACCATGACTTTTGATCAGCTCTTC
CCCGTCTTCCTCAGCACCTCGCCGCTTCAGCACCCAGTGCGCGAGTTGCCCTTCAAGTTCGCGGATGGCTTCGGC
CTCGACACCAAGTCCATCGGCGTCGTCATGTCTATCCAGGGCGTCTACTCGCTCCTCTCCAACTACATCATCGTT
CCCCCCGTCACTCGACGCCTCGGCTCCCTTCGGCTCTTCCGCATGCTCGCCTTCTCCTACTTTGCCCTCTACCTC
GTCACGCCGTACCTAGTACTGCTCCCGACGAACCTACGGATGCCGGCCGTCTACGCCCTCGTAATCTGGAAGTGC
ACCTACGCGACAATGGCGTACCCGAACAATGCTATCCTACTGGCCAACGCGGCACCCAGCAAACAGGTGCTCGGC
ACCATCAACGGCGTGGCCGCGTCGACGGCGAGCCTGTGCCGCGCTCTGGGGCCCACGCTCTCGGGTGTTCTGTAC
GCGGTTGGCTTGAGGACGGGGTACTCGGGCCTCGCATGGTGGTTCAGCGGGCTGGTCACCGTCGTTGGCGCCTAC
TTGAGCTCGCGAATTACCGAGGGCGAGACGCAAACCGTTCCGACAGAAGAGGAGGAGGCGCTGTTGGAGGATGCG
CTCCTCTACAGCGAGGACGAGGCCGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail