Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8375
Gene name
Locationscaffold_92:38186..39777
Strand-
Gene length (bp)1591
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.1E-17 307 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10355|YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.02 PE=3 SV=1 280 394 4.0E-33
sp|A2VDB3|RBM42_XENLA RNA-binding protein 42 OS=Xenopus laevis GN=rbm42 PE=2 SV=1 283 397 2.0E-30
sp|Q6DRG1|RBM42_DANRE RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=2 SV=2 283 397 9.0E-30
sp|Q0P5L0|RBM42_BOVIN RNA-binding protein 42 OS=Bos taurus GN=RBM42 PE=2 SV=1 283 381 1.0E-29
sp|Q6AXT7|RBM42_RAT RNA-binding protein 42 OS=Rattus norvegicus GN=Rbm42 PE=1 SV=1 283 381 2.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10355|YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.02 PE=3 SV=1 280 394 4.0E-33
sp|A2VDB3|RBM42_XENLA RNA-binding protein 42 OS=Xenopus laevis GN=rbm42 PE=2 SV=1 283 397 2.0E-30
sp|Q6DRG1|RBM42_DANRE RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=2 SV=2 283 397 9.0E-30
sp|Q0P5L0|RBM42_BOVIN RNA-binding protein 42 OS=Bos taurus GN=RBM42 PE=2 SV=1 283 381 1.0E-29
sp|Q6AXT7|RBM42_RAT RNA-binding protein 42 OS=Rattus norvegicus GN=Rbm42 PE=1 SV=1 283 381 2.0E-29
sp|Q9BTD8|RBM42_HUMAN RNA-binding protein 42 OS=Homo sapiens GN=RBM42 PE=1 SV=1 283 381 2.0E-29
sp|Q91V81|RBM42_MOUSE RNA-binding protein 42 OS=Mus musculus GN=Rbm42 PE=1 SV=1 283 381 2.0E-29
sp|Q66KL9|RBM42_XENTR RNA-binding protein 42 OS=Xenopus tropicalis GN=rbm42 PE=2 SV=1 283 397 2.0E-29
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 303 376 2.0E-13
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 303 376 2.0E-13
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 306 381 1.0E-12
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 306 381 3.0E-12
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 306 381 1.0E-11
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 306 381 1.0E-11
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 306 381 2.0E-11
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 303 376 2.0E-11
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 303 376 2.0E-11
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 306 381 3.0E-11
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 306 381 3.0E-11
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 306 381 3.0E-11
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 306 381 4.0E-11
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 302 376 5.0E-11
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 306 381 6.0E-11
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 306 381 6.0E-11
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 306 381 8.0E-11
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 302 378 9.0E-11
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 306 381 9.0E-11
sp|P0C8Z4|RMXL3_PANTR RNA-binding motif protein, X-linked-like-3 OS=Pan troglodytes GN=RBMXL3 PE=3 SV=1 306 378 1.0E-10
sp|Q8N7X1|RMXL3_HUMAN RNA-binding motif protein, X-linked-like-3 OS=Homo sapiens GN=RBMXL3 PE=2 SV=2 306 378 3.0E-10
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 306 381 4.0E-10
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 305 414 4.0E-10
sp|Q9C652|RBP1_ARATH RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBP1 PE=2 SV=1 301 381 5.0E-10
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 304 371 5.0E-10
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 307 400 6.0E-10
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 304 371 6.0E-10
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 301 378 7.0E-10
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 306 381 7.0E-10
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 306 381 8.0E-10
sp|Q9LKA4|UBA2C_ARATH UBP1-associated protein 2C OS=Arabidopsis thaliana GN=UBA2C PE=2 SV=1 272 365 1.0E-09
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 306 381 1.0E-09
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 306 381 1.0E-09
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 306 381 2.0E-09
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 306 381 2.0E-09
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 306 381 2.0E-09
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 306 381 2.0E-09
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 306 381 2.0E-09
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 303 371 3.0E-09
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 303 371 3.0E-09
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 306 381 3.0E-09
sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 307 420 4.0E-09
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 306 381 4.0E-09
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 303 378 4.0E-09
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 307 405 5.0E-09
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 306 381 5.0E-09
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 306 381 6.0E-09
sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 306 381 6.0E-09
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 306 382 7.0E-09
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 306 381 8.0E-09
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 306 381 8.0E-09
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 306 381 8.0E-09
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 305 378 8.0E-09
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 306 381 8.0E-09
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 306 381 8.0E-09
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 302 382 9.0E-09
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 306 381 9.0E-09
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 305 386 1.0E-08
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 306 385 1.0E-08
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 306 382 1.0E-08
sp|Q7T3I7|RBM38_XENLA RNA-binding protein 38 OS=Xenopus laevis GN=rbm38 PE=1 SV=2 298 385 1.0E-08
sp|Q9H0Z9|RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens GN=RBM38 PE=1 SV=2 301 402 1.0E-08
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 306 382 2.0E-08
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 307 401 2.0E-08
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 285 378 2.0E-08
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 285 378 2.0E-08
sp|Q76LC6|RBM24_DANRE RNA-binding protein 24 OS=Danio rerio GN=rbm24 PE=2 SV=1 301 385 2.0E-08
sp|Q9I8B3|RB24B_XENLA RNA-binding protein 24-B OS=Xenopus laevis GN=rbm24-b PE=2 SV=1 301 385 3.0E-08
sp|P38760|MIP6_YEAST RNA-binding protein MIP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIP6 PE=1 SV=1 307 367 3.0E-08
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 306 382 3.0E-08
sp|Q6GQD3|RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis GN=rbm24-a PE=2 SV=1 301 402 3.0E-08
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 298 381 3.0E-08
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 307 378 3.0E-08
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 306 381 4.0E-08
sp|Q05AT9|U1SBP_XENLA U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Xenopus laevis GN=snrnp35 PE=2 SV=1 301 378 4.0E-08
sp|Q9CX86|ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus GN=Hnrnpa0 PE=1 SV=1 306 381 4.0E-08
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 306 381 4.0E-08
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 306 381 4.0E-08
sp|Q6P8A7|RBM24_XENTR RNA-binding protein 24 OS=Xenopus tropicalis GN=rbm24 PE=2 SV=1 301 385 4.0E-08
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 301 354 4.0E-08
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 301 354 4.0E-08
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 301 354 4.0E-08
sp|Q5ZJX4|RBM38_CHICK RNA-binding protein 38 OS=Gallus gallus GN=RBM38 PE=2 SV=1 298 385 4.0E-08
sp|Q6DIV4|RBM38_XENTR RNA-binding protein 38 OS=Xenopus tropicalis GN=rbm38 PE=2 SV=1 298 385 5.0E-08
sp|Q9BX46|RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens GN=RBM24 PE=1 SV=1 301 385 5.0E-08
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 306 381 6.0E-08
sp|D3Z4I3|RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus GN=Rbm24 PE=3 SV=1 301 385 6.0E-08
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 306 381 6.0E-08
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 306 406 7.0E-08
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 306 397 7.0E-08
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 306 381 7.0E-08
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 301 358 7.0E-08
sp|Q5ZMA3|RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus GN=RBM24 PE=2 SV=2 301 385 7.0E-08
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 307 381 7.0E-08
sp|Q00539|NAM8_YEAST Protein NAM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM8 PE=1 SV=2 307 378 7.0E-08
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 306 381 8.0E-08
sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 307 381 8.0E-08
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 300 391 9.0E-08
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 301 354 9.0E-08
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 306 381 9.0E-08
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 301 358 1.0E-07
sp|Q1LZH0|U1SBP_BOVIN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Bos taurus GN=SNRNP35 PE=2 SV=1 305 378 1.0E-07
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 301 358 1.0E-07
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 301 358 1.0E-07
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 301 358 1.0E-07
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 305 378 1.0E-07
sp|Q5U1W5|U1SBP_RAT U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Rattus norvegicus GN=Snrnp35 PE=2 SV=1 305 378 1.0E-07
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 301 358 1.0E-07
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 300 391 1.0E-07
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 301 358 1.0E-07
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 301 358 1.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 290 378 1.0E-07
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 301 354 1.0E-07
sp|Q62176|RBM38_MOUSE RNA-binding protein 38 OS=Mus musculus GN=Rbm38 PE=1 SV=2 301 402 1.0E-07
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 307 378 1.0E-07
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 293 368 1.0E-07
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 305 368 2.0E-07
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 306 380 2.0E-07
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 301 418 2.0E-07
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 278 381 2.0E-07
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 278 381 2.0E-07
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 305 391 2.0E-07
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 301 355 2.0E-07
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 307 386 3.0E-07
sp|Q9D384|U1SBP_MOUSE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Mus musculus GN=Snrnp35 PE=2 SV=1 305 378 3.0E-07
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 301 354 3.0E-07
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 290 378 3.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 307 389 4.0E-07
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 307 391 4.0E-07
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 305 381 4.0E-07
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 307 381 4.0E-07
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 301 396 4.0E-07
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 307 378 4.0E-07
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 307 378 4.0E-07
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 307 378 4.0E-07
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 307 378 4.0E-07
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 301 396 4.0E-07
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 307 425 5.0E-07
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 301 391 5.0E-07
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 307 378 5.0E-07
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 282 414 5.0E-07
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 307 378 5.0E-07
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 278 381 6.0E-07
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 301 391 6.0E-07
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 307 381 6.0E-07
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 307 381 6.0E-07
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 307 368 7.0E-07
sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 300 378 8.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 307 399 8.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 305 381 8.0E-07
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 307 368 8.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 307 378 9.0E-07
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 306 381 9.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 307 387 1.0E-06
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 279 391 1.0E-06
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 307 376 1.0E-06
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 280 378 1.0E-06
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 295 372 1.0E-06
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 306 398 1.0E-06
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 305 381 1.0E-06
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 305 378 2.0E-06
sp|Q00916|RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNP1 PE=1 SV=1 291 366 2.0E-06
sp|Q9IBD1|CELF3_DANRE CUGBP Elav-like family member 3 OS=Danio rerio GN=celf3 PE=2 SV=2 302 371 2.0E-06
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 306 369 2.0E-06
sp|Q16560|U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens GN=SNRNP35 PE=1 SV=1 305 378 2.0E-06
sp|Q8VY74|U1135_ARATH U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Arabidopsis thaliana GN=SNRNP35 PE=1 SV=1 307 378 3.0E-06
sp|Q5R9H4|A1CF_PONAB APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1 307 401 3.0E-06
sp|Q8CIN6|CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus GN=Celf3 PE=2 SV=1 302 371 3.0E-06
sp|Q5SZQ8|CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens GN=CELF3 PE=1 SV=1 302 371 3.0E-06
sp|Q08E07|CELF3_BOVIN CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1 302 371 3.0E-06
sp|Q9NQ94|A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1 307 401 3.0E-06
sp|Q7ZWM3|CEL3B_XENLA CUGBP Elav-like family member 3-B OS=Xenopus laevis GN=tnrc4-b PE=2 SV=1 234 371 3.0E-06
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 305 378 4.0E-06
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 305 378 4.0E-06
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 302 381 4.0E-06
sp|Q91579|CEL3A_XENLA CUGBP Elav-like family member 3-A OS=Xenopus laevis GN=tnrc4-a PE=2 SV=2 302 371 5.0E-06
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 298 354 5.0E-06
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 304 414 7.0E-06
sp|P39697|RT19_ARATH 40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana GN=RPS19 PE=1 SV=2 306 381 7.0E-06
sp|P17133|RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster GN=snRNP-U1-70K PE=1 SV=2 300 378 8.0E-06
sp|B4PIS2|SHEP_DROYA Protein alan shepard OS=Drosophila yakuba GN=shep PE=3 SV=1 303 374 9.0E-06
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 298 354 9.0E-06
sp|B3NGA1|SHEP_DROER Protein alan shepard OS=Drosophila erecta GN=shep PE=3 SV=1 303 374 9.0E-06
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 306 406 9.0E-06
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 306 372 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 65.59 35.91 95.28
CcL In ants, during behavior modification 55.43 29.96 80.89
CcD In ants, recently dead 77.70 42.13 113.26

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.499622 no
SC16a CcD 0.495269 no
CcL CcD 0.148405 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8375
MSKLGSRRISSIIYLLVSNVLLNIFPSQLAEGRKKPSNNNVVRHPIIHQQALAGDPEKAPPEVSFERSQSARGTT
NSLPARPPASSNSKQGFRPAFASAQPFQAPGTYPPGSANYSGAAASNYASPSNYPPRSHYGASAQYGSAAAYSSS
SYPGYTASAPGVNSATPGYGYGSQQQPQHAQLPSQQQQPPQQPPQQPGYGSQNVSGYATSSYAPPQIQNPFPAPG
TAASTFDPSEAAQIAEWQSTYNGIPQISRDGKPLGLVSEPAKPDSPAVTANPDKKKTVVRQGGGKKWTDDTLLEW
DPSHLRLFVGNLAGETTDESLLKAFSRWKSVQKARVIRDKRTTKSKGYGFVSFSNPDDFFQAAKEMNGKYIQSHP
VVVRKANTEIKVSSVKDKTKGGGGGGGGGGKNAGGKNNNKNKKNNGSGGGGGSVVAGYEPSLGPVTGAGVTKPGQ
KTKNGLRLLG
Coding >Ophio5|8375
ATGAGCAAGCTTGGATCGAGACGCATATCTTCCATCATCTATCTGCTCGTCTCCAACGTTCTGCTCAACATCTTC
CCGTCGCAACTTGCGGAGGGGAGAAAAAAACCTTCAAATAATAACGTCGTTCGTCATCCCATCATTCACCAACAA
GCCCTGGCCGGTGACCCTGAGAAGGCGCCCCCGGAGGTAAGCTTTGAGCGCAGTCAGTCAGCTCGAGGCACCACC
AACTCGCTTCCCGCGAGACCGCCGGCGTCCTCCAACAGCAAACAGGGCTTCAGGCCGGCCTTTGCCTCGGCTCAG
CCTTTCCAGGCCCCCGGGACATATCCTCCTGGCTCCGCCAACTATTCCGGCGCCGCTGCGAGCAACTATGCCTCT
CCGAGCAACTATCCACCTCGCTCCCACTACGGCGCCTCCGCTCAGTACGGATCCGCTGCTGCATACTCTTCCTCC
TCGTATCCGGGCTACACCGCTTCTGCGCCCGGGGTGAACTCGGCCACACCGGGCTACGGCTACGGCTCGCAGCAG
CAGCCTCAGCACGCTCAGCTGCCGTCGCAACAACAGCAGCCTCCTCAGCAGCCTCCCCAACAGCCGGGCTACGGT
TCCCAGAACGTCAGCGGTTACGCCACCTCGAGCTACGCGCCGCCGCAGATTCAGAACCCCTTCCCCGCGCCGGGC
ACCGCTGCGAGCACCTTCGACCCGTCCGAGGCGGCGCAGATCGCCGAATGGCAGAGCACCTACAACGGCATTCCC
CAAATCAGCCGCGACGGCAAGCCCCTTGGCCTAGTTTCGGAGCCCGCCAAGCCCGACTCTCCGGCCGTGACCGCG
AACCCGGACAAGAAGAAGACGGTGGTGCGCCAGGGCGGCGGCAAGAAATGGACCGACGACACGCTGCTCGAATGG
GACCCGTCCCACCTACGCCTCTTCGTCGGCAACCTCGCTGGTGAGACGACGGACGAATCCCTCCTCAAGGCCTTT
TCCCGCTGGAAGTCGGTACAAAAGGCGCGCGTCATCCGCGACAAGCGCACCACCAAGTCAAAGGGCTACGGCTTC
GTCAGCTTCAGCAACCCGGACGACTTCTTCCAAGCCGCCAAGGAGATGAACGGGAAATACATCCAGAGCCACCCG
GTCGTCGTCCGCAAGGCAAACACCGAGATCAAGGTCTCGAGCGTCAAGGACAAGACAAAGGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGCAAGAACGCCGGCGGCAAGAACAACAACAAGAATAAGAAGAACAACGGTTCCGGAGGCGGA
GGGGGTTCCGTCGTCGCTGGGTACGAGCCCAGTCTCGGTCCCGTCACCGGAGCGGGCGTCACCAAGCCCGGACAG
AAGACCAAGAATGGACTGCGACTCCTGGGC
Transcript >Ophio5|8375
ATGAGCAAGCTTGGATCGAGACGCATATCTTCCATCATCTATCTGCTCGTCTCCAACGTTCTGCTCAACATCTTC
CCGTCGCAACTTGCGGAGGGGAGAAAAAAACCTTCAAATAATAACGTCGTTCGTCATCCCATCATTCACCAACAA
GCCCTGGCCGGTGACCCTGAGAAGGCGCCCCCGGAGGTAAGCTTTGAGCGCAGTCAGTCAGCTCGAGGCACCACC
AACTCGCTTCCCGCGAGACCGCCGGCGTCCTCCAACAGCAAACAGGGCTTCAGGCCGGCCTTTGCCTCGGCTCAG
CCTTTCCAGGCCCCCGGGACATATCCTCCTGGCTCCGCCAACTATTCCGGCGCCGCTGCGAGCAACTATGCCTCT
CCGAGCAACTATCCACCTCGCTCCCACTACGGCGCCTCCGCTCAGTACGGATCCGCTGCTGCATACTCTTCCTCC
TCGTATCCGGGCTACACCGCTTCTGCGCCCGGGGTGAACTCGGCCACACCGGGCTACGGCTACGGCTCGCAGCAG
CAGCCTCAGCACGCTCAGCTGCCGTCGCAACAACAGCAGCCTCCTCAGCAGCCTCCCCAACAGCCGGGCTACGGT
TCCCAGAACGTCAGCGGTTACGCCACCTCGAGCTACGCGCCGCCGCAGATTCAGAACCCCTTCCCCGCGCCGGGC
ACCGCTGCGAGCACCTTCGACCCGTCCGAGGCGGCGCAGATCGCCGAATGGCAGAGCACCTACAACGGCATTCCC
CAAATCAGCCGCGACGGCAAGCCCCTTGGCCTAGTTTCGGAGCCCGCCAAGCCCGACTCTCCGGCCGTGACCGCG
AACCCGGACAAGAAGAAGACGGTGGTGCGCCAGGGCGGCGGCAAGAAATGGACCGACGACACGCTGCTCGAATGG
GACCCGTCCCACCTACGCCTCTTCGTCGGCAACCTCGCTGGTGAGACGACGGACGAATCCCTCCTCAAGGCCTTT
TCCCGCTGGAAGTCGGTACAAAAGGCGCGCGTCATCCGCGACAAGCGCACCACCAAGTCAAAGGGCTACGGCTTC
GTCAGCTTCAGCAACCCGGACGACTTCTTCCAAGCCGCCAAGGAGATGAACGGGAAATACATCCAGAGCCACCCG
GTCGTCGTCCGCAAGGCAAACACCGAGATCAAGGTCTCGAGCGTCAAGGACAAGACAAAGGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGCAAGAACGCCGGCGGCAAGAACAACAACAAGAATAAGAAGAACAACGGTTCCGGAGGCGGA
GGGGGTTCCGTCGTCGCTGGGTACGAGCCCAGTCTCGGTCCCGTCACCGGAGCGGGCGTCACCAAGCCCGGACAG
AAGACCAAGAATGGACTGCGACTCCTGGGCTAG
Gene >Ophio5|8375
ATGAGCAAGCTTGGATCGAGACGCATATCTTCCATCATCTATCTGCTCGTCTCCAACGTGTGTGTTCGAATACCG
GGTTGCGCCGTTCAGGAAGCATGGAGTCGTATTCGTATTCGTACTGTACTGGCTCCTCCGTCAGGCACCGCTGCA
ACAGCGAGCACGTGACTTACTAGCACCCTTCGTCTGACGCAGTCTGCTCAACATCTTCCCGTCGCAACTTGCGGA
GGGGAGAAAAAAACCTTCAAATAATAACGTCGTTCGTCATCCCATCATTCACCAACAAGCCCTGGCCGGTGACCC
TGAGAAGGCGCCCCCGGAGGTAAGCTTTGAGCGCAGTCAGTCAGCTCGAGGTACGTGCCGCACACGCTAGAAGCC
AAAGCCCCCATCGCTCTGGTTGTTTATTATGGCATACGCGCCGCCTCCAGGCACCACCAACTCGCTTCCCGCGAG
ACCGCCGGCGTCCTCCAACAGCAAACAGGGCTTCAGGCCGGCCTTTGCCTCGGCTCAGCCTTTCCAGGCCCCCGG
GACATATCCTCCTGGCTCCGCCAACTATTCCGGCGCCGCTGCGAGCAACTATGCCTCTCCGAGCAACTATCCACC
TCGCTCCCACTACGGCGCCTCCGCTCAGTACGGATCCGCTGCTGCATACTCTTCCTCCTCGTATCCGGGCTACAC
CGCTTCTGCGCCCGGGGTGAACTCGGCCACACCGGGCTACGGCTACGGCTCGCAGCAGCAGCCTCAGCACGCTCA
GCTGCCGTCGCAACAACAGCAGCCTCCTCAGCAGCCTCCCCAACAGCCGGGCTACGGTTCCCAGAACGTCAGCGG
TTACGCCACCTCGAGCTACGCGCCGCCGCAGATTCAGAACCCCTTCCCCGCGCCGGGCACCGCTGCGAGCACCTT
CGACCCGTCCGAGGCGGCGCAGATCGCCGAATGGCAGAGCACCTACAACGGCATTCCCCAAATCAGCCGCGACGG
CAAGCCCCTTGGCCTAGTTTCGGAGCCCGCCAAGCCCGACTCTCCGGCCGTGACCGCGAACCCGGACAAGAAGAA
GACGGTGGTGCGCCAGGGCGGCGGCAAGAAATGGACCGACGACACGCTGCTCGAATGGGACCCGTCCCACCTACG
CCTCTTCGTCGGCAACCTCGCTGGTGAGACGACGGACGAATCCCTCCTCAAGGCCTTTTCCCGCTGGAAGTCGGT
ACAAAAGGCGCGCGTCATCCGCGACAAGCGCACCACCAAGTCAAAGGGCTACGGCTTCGTCAGCTTCAGCAACCC
GGACGACTTCTTCCAAGCCGCCAAGGAGATGAACGGGAAATACATCCAGAGCCACCCGGTCGTCGTCCGCAAGGC
AAACACCGAGATCAAGGTCTCGAGCGTCAAGGACAAGACAAAGGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCAA
GAACGCCGGCGGCAAGAACAACAACAAGAATAAGAAGAACAACGGTTCCGGAGGCGGAGGGGGTTCCGTCGTCGC
TGGGTACGAGCCCAGTCTCGGTCCCGTCACCGGAGCGGGCGTCACCAAGCCCGGACAGAAGACCAAGAATGGACT
GCGACTCCTGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail