Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8375
Gene name
Locationscaffold_92:38186..39777
Strand-
Gene length (bp)1591
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.1E-17 307 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10355|YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.02 PE=3 SV=1 280 394 4.0E-33
sp|A2VDB3|RBM42_XENLA RNA-binding protein 42 OS=Xenopus laevis GN=rbm42 PE=2 SV=1 283 397 2.0E-30
sp|Q6DRG1|RBM42_DANRE RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=2 SV=2 283 397 9.0E-30
sp|Q0P5L0|RBM42_BOVIN RNA-binding protein 42 OS=Bos taurus GN=RBM42 PE=2 SV=1 283 381 1.0E-29
sp|Q6AXT7|RBM42_RAT RNA-binding protein 42 OS=Rattus norvegicus GN=Rbm42 PE=1 SV=1 283 381 2.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10355|YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.02 PE=3 SV=1 280 394 4.0E-33
sp|A2VDB3|RBM42_XENLA RNA-binding protein 42 OS=Xenopus laevis GN=rbm42 PE=2 SV=1 283 397 2.0E-30
sp|Q6DRG1|RBM42_DANRE RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=2 SV=2 283 397 9.0E-30
sp|Q0P5L0|RBM42_BOVIN RNA-binding protein 42 OS=Bos taurus GN=RBM42 PE=2 SV=1 283 381 1.0E-29
sp|Q6AXT7|RBM42_RAT RNA-binding protein 42 OS=Rattus norvegicus GN=Rbm42 PE=1 SV=1 283 381 2.0E-29
sp|Q9BTD8|RBM42_HUMAN RNA-binding protein 42 OS=Homo sapiens GN=RBM42 PE=1 SV=1 283 381 2.0E-29
sp|Q91V81|RBM42_MOUSE RNA-binding protein 42 OS=Mus musculus GN=Rbm42 PE=1 SV=1 283 381 2.0E-29
sp|Q66KL9|RBM42_XENTR RNA-binding protein 42 OS=Xenopus tropicalis GN=rbm42 PE=2 SV=1 283 397 2.0E-29
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 303 376 2.0E-13
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 303 376 2.0E-13
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 306 381 1.0E-12
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 306 381 3.0E-12
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 306 381 1.0E-11
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 306 381 1.0E-11
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 306 381 2.0E-11
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 303 376 2.0E-11
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 303 376 2.0E-11
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 306 381 3.0E-11
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 306 381 3.0E-11
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 306 381 3.0E-11
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 306 381 4.0E-11
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 302 376 5.0E-11
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 306 381 6.0E-11
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 306 381 6.0E-11
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 306 381 8.0E-11
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 302 378 9.0E-11
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 306 381 9.0E-11
sp|P0C8Z4|RMXL3_PANTR RNA-binding motif protein, X-linked-like-3 OS=Pan troglodytes GN=RBMXL3 PE=3 SV=1 306 378 1.0E-10
sp|Q8N7X1|RMXL3_HUMAN RNA-binding motif protein, X-linked-like-3 OS=Homo sapiens GN=RBMXL3 PE=2 SV=2 306 378 3.0E-10
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 306 381 4.0E-10
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 305 414 4.0E-10
sp|Q9C652|RBP1_ARATH RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBP1 PE=2 SV=1 301 381 5.0E-10
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 304 371 5.0E-10
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 307 400 6.0E-10
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 304 371 6.0E-10
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 301 378 7.0E-10
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 306 381 7.0E-10
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 306 381 8.0E-10
sp|Q9LKA4|UBA2C_ARATH UBP1-associated protein 2C OS=Arabidopsis thaliana GN=UBA2C PE=2 SV=1 272 365 1.0E-09
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 306 381 1.0E-09
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 306 381 1.0E-09
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 306 381 2.0E-09
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 306 381 2.0E-09
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 306 381 2.0E-09
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 306 381 2.0E-09
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 306 381 2.0E-09
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 303 371 3.0E-09
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 303 371 3.0E-09
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 306 381 3.0E-09
sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 307 420 4.0E-09
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 306 381 4.0E-09
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 303 378 4.0E-09
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 307 405 5.0E-09
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 306 381 5.0E-09
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 306 381 6.0E-09
sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 306 381 6.0E-09
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 306 382 7.0E-09
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 306 381 8.0E-09
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 306 381 8.0E-09
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 306 381 8.0E-09
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 305 378 8.0E-09
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 306 381 8.0E-09
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 306 381 8.0E-09
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 302 382 9.0E-09
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 306 381 9.0E-09
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 305 386 1.0E-08
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 306 385 1.0E-08
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 306 382 1.0E-08
sp|Q7T3I7|RBM38_XENLA RNA-binding protein 38 OS=Xenopus laevis GN=rbm38 PE=1 SV=2 298 385 1.0E-08
sp|Q9H0Z9|RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens GN=RBM38 PE=1 SV=2 301 402 1.0E-08
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 306 382 2.0E-08
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 307 401 2.0E-08
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 285 378 2.0E-08
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 285 378 2.0E-08
sp|Q76LC6|RBM24_DANRE RNA-binding protein 24 OS=Danio rerio GN=rbm24 PE=2 SV=1 301 385 2.0E-08
sp|Q9I8B3|RB24B_XENLA RNA-binding protein 24-B OS=Xenopus laevis GN=rbm24-b PE=2 SV=1 301 385 3.0E-08
sp|P38760|MIP6_YEAST RNA-binding protein MIP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIP6 PE=1 SV=1 307 367 3.0E-08
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 306 382 3.0E-08
sp|Q6GQD3|RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis GN=rbm24-a PE=2 SV=1 301 402 3.0E-08
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 298 381 3.0E-08
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 307 378 3.0E-08
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 306 381 4.0E-08
sp|Q05AT9|U1SBP_XENLA U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Xenopus laevis GN=snrnp35 PE=2 SV=1 301 378 4.0E-08
sp|Q9CX86|ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus GN=Hnrnpa0 PE=1 SV=1 306 381 4.0E-08
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 306 381 4.0E-08
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 306 381 4.0E-08
sp|Q6P8A7|RBM24_XENTR RNA-binding protein 24 OS=Xenopus tropicalis GN=rbm24 PE=2 SV=1 301 385 4.0E-08
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 301 354 4.0E-08
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 301 354 4.0E-08
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 301 354 4.0E-08
sp|Q5ZJX4|RBM38_CHICK RNA-binding protein 38 OS=Gallus gallus GN=RBM38 PE=2 SV=1 298 385 4.0E-08
sp|Q6DIV4|RBM38_XENTR RNA-binding protein 38 OS=Xenopus tropicalis GN=rbm38 PE=2 SV=1 298 385 5.0E-08
sp|Q9BX46|RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens GN=RBM24 PE=1 SV=1 301 385 5.0E-08
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 306 381 6.0E-08
sp|D3Z4I3|RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus GN=Rbm24 PE=3 SV=1 301 385 6.0E-08
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 306 381 6.0E-08
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 306 406 7.0E-08
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 306 397 7.0E-08
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 306 381 7.0E-08
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 301 358 7.0E-08
sp|Q5ZMA3|RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus GN=RBM24 PE=2 SV=2 301 385 7.0E-08
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 307 381 7.0E-08
sp|Q00539|NAM8_YEAST Protein NAM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM8 PE=1 SV=2 307 378 7.0E-08
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 306 381 8.0E-08
sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 307 381 8.0E-08
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 300 391 9.0E-08
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 301 354 9.0E-08
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 306 381 9.0E-08
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 301 358 1.0E-07
sp|Q1LZH0|U1SBP_BOVIN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Bos taurus GN=SNRNP35 PE=2 SV=1 305 378 1.0E-07
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 301 358 1.0E-07
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 301 358 1.0E-07
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 301 358 1.0E-07
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 305 378 1.0E-07
sp|Q5U1W5|U1SBP_RAT U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Rattus norvegicus GN=Snrnp35 PE=2 SV=1 305 378 1.0E-07
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 301 358 1.0E-07
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 300 391 1.0E-07
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 301 358 1.0E-07
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 301 358 1.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 290 378 1.0E-07
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 301 354 1.0E-07
sp|Q62176|RBM38_MOUSE RNA-binding protein 38 OS=Mus musculus GN=Rbm38 PE=1 SV=2 301 402 1.0E-07
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 307 378 1.0E-07
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 293 368 1.0E-07
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 305 368 2.0E-07
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 306 380 2.0E-07
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 301 418 2.0E-07
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 278 381 2.0E-07
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 278 381 2.0E-07
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 305 391 2.0E-07
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 301 355 2.0E-07
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 307 386 3.0E-07
sp|Q9D384|U1SBP_MOUSE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Mus musculus GN=Snrnp35 PE=2 SV=1 305 378 3.0E-07
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 301 354 3.0E-07
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 290 378 3.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 307 389 4.0E-07
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 307 391 4.0E-07
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 305 381 4.0E-07
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 307 381 4.0E-07
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 301 396 4.0E-07
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 307 378 4.0E-07
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 307 378 4.0E-07
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 307 378 4.0E-07
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 307 378 4.0E-07
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 301 396 4.0E-07
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 307 425 5.0E-07
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 301 391 5.0E-07
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 307 378 5.0E-07
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 282 414 5.0E-07
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 307 378 5.0E-07
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 278 381 6.0E-07
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 301 391 6.0E-07
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 307 381 6.0E-07
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 307 381 6.0E-07
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 307 368 7.0E-07
sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 300 378 8.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 307 399 8.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 305 381 8.0E-07
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 307 368 8.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 307 378 9.0E-07
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 306 381 9.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 307 387 1.0E-06
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 279 391 1.0E-06
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 307 376 1.0E-06
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 280 378 1.0E-06
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 295 372 1.0E-06
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 306 398 1.0E-06
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 305 381 1.0E-06
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 305 378 2.0E-06
sp|Q00916|RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNP1 PE=1 SV=1 291 366 2.0E-06
sp|Q9IBD1|CELF3_DANRE CUGBP Elav-like family member 3 OS=Danio rerio GN=celf3 PE=2 SV=2 302 371 2.0E-06
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 306 369 2.0E-06
sp|Q16560|U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens GN=SNRNP35 PE=1 SV=1 305 378 2.0E-06
sp|Q8VY74|U1135_ARATH U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Arabidopsis thaliana GN=SNRNP35 PE=1 SV=1 307 378 3.0E-06
sp|Q5R9H4|A1CF_PONAB APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1 307 401 3.0E-06
sp|Q8CIN6|CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus GN=Celf3 PE=2 SV=1 302 371 3.0E-06
sp|Q5SZQ8|CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens GN=CELF3 PE=1 SV=1 302 371 3.0E-06
sp|Q08E07|CELF3_BOVIN CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1 302 371 3.0E-06
sp|Q9NQ94|A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1 307 401 3.0E-06
sp|Q7ZWM3|CEL3B_XENLA CUGBP Elav-like family member 3-B OS=Xenopus laevis GN=tnrc4-b PE=2 SV=1 234 371 3.0E-06
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 305 378 4.0E-06
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 305 378 4.0E-06
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 302 381 4.0E-06
sp|Q91579|CEL3A_XENLA CUGBP Elav-like family member 3-A OS=Xenopus laevis GN=tnrc4-a PE=2 SV=2 302 371 5.0E-06
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 298 354 5.0E-06
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 304 414 7.0E-06
sp|P39697|RT19_ARATH 40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana GN=RPS19 PE=1 SV=2 306 381 7.0E-06
sp|P17133|RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster GN=snRNP-U1-70K PE=1 SV=2 300 378 8.0E-06
sp|B4PIS2|SHEP_DROYA Protein alan shepard OS=Drosophila yakuba GN=shep PE=3 SV=1 303 374 9.0E-06
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 298 354 9.0E-06
sp|B3NGA1|SHEP_DROER Protein alan shepard OS=Drosophila erecta GN=shep PE=3 SV=1 303 374 9.0E-06
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 306 406 9.0E-06
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 306 372 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8375
MSKLGSRRISSIIYLLVSNVLLNIFPSQLAEGRKKPSNNNVVRHPIIHQQALAGDPEKAPPEVSFERSQSARGTT
NSLPARPPASSNSKQGFRPAFASAQPFQAPGTYPPGSANYSGAAASNYASPSNYPPRSHYGASAQYGSAAAYSSS
SYPGYTASAPGVNSATPGYGYGSQQQPQHAQLPSQQQQPPQQPPQQPGYGSQNVSGYATSSYAPPQIQNPFPAPG
TAASTFDPSEAAQIAEWQSTYNGIPQISRDGKPLGLVSEPAKPDSPAVTANPDKKKTVVRQGGGKKWTDDTLLEW
DPSHLRLFVGNLAGETTDESLLKAFSRWKSVQKARVIRDKRTTKSKGYGFVSFSNPDDFFQAAKEMNGKYIQSHP
VVVRKANTEIKVSSVKDKTKGGGGGGGGGGKNAGGKNNNKNKKNNGSGGGGGSVVAGYEPSLGPVTGAGVTKPGQ
KTKNGLRLLG
Coding >Ophio5|8375
ATGAGCAAGCTTGGATCGAGACGCATATCTTCCATCATCTATCTGCTCGTCTCCAACGTTCTGCTCAACATCTTC
CCGTCGCAACTTGCGGAGGGGAGAAAAAAACCTTCAAATAATAACGTCGTTCGTCATCCCATCATTCACCAACAA
GCCCTGGCCGGTGACCCTGAGAAGGCGCCCCCGGAGGTAAGCTTTGAGCGCAGTCAGTCAGCTCGAGGCACCACC
AACTCGCTTCCCGCGAGACCGCCGGCGTCCTCCAACAGCAAACAGGGCTTCAGGCCGGCCTTTGCCTCGGCTCAG
CCTTTCCAGGCCCCCGGGACATATCCTCCTGGCTCCGCCAACTATTCCGGCGCCGCTGCGAGCAACTATGCCTCT
CCGAGCAACTATCCACCTCGCTCCCACTACGGCGCCTCCGCTCAGTACGGATCCGCTGCTGCATACTCTTCCTCC
TCGTATCCGGGCTACACCGCTTCTGCGCCCGGGGTGAACTCGGCCACACCGGGCTACGGCTACGGCTCGCAGCAG
CAGCCTCAGCACGCTCAGCTGCCGTCGCAACAACAGCAGCCTCCTCAGCAGCCTCCCCAACAGCCGGGCTACGGT
TCCCAGAACGTCAGCGGTTACGCCACCTCGAGCTACGCGCCGCCGCAGATTCAGAACCCCTTCCCCGCGCCGGGC
ACCGCTGCGAGCACCTTCGACCCGTCCGAGGCGGCGCAGATCGCCGAATGGCAGAGCACCTACAACGGCATTCCC
CAAATCAGCCGCGACGGCAAGCCCCTTGGCCTAGTTTCGGAGCCCGCCAAGCCCGACTCTCCGGCCGTGACCGCG
AACCCGGACAAGAAGAAGACGGTGGTGCGCCAGGGCGGCGGCAAGAAATGGACCGACGACACGCTGCTCGAATGG
GACCCGTCCCACCTACGCCTCTTCGTCGGCAACCTCGCTGGTGAGACGACGGACGAATCCCTCCTCAAGGCCTTT
TCCCGCTGGAAGTCGGTACAAAAGGCGCGCGTCATCCGCGACAAGCGCACCACCAAGTCAAAGGGCTACGGCTTC
GTCAGCTTCAGCAACCCGGACGACTTCTTCCAAGCCGCCAAGGAGATGAACGGGAAATACATCCAGAGCCACCCG
GTCGTCGTCCGCAAGGCAAACACCGAGATCAAGGTCTCGAGCGTCAAGGACAAGACAAAGGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGCAAGAACGCCGGCGGCAAGAACAACAACAAGAATAAGAAGAACAACGGTTCCGGAGGCGGA
GGGGGTTCCGTCGTCGCTGGGTACGAGCCCAGTCTCGGTCCCGTCACCGGAGCGGGCGTCACCAAGCCCGGACAG
AAGACCAAGAATGGACTGCGACTCCTGGGC
Transcript >Ophio5|8375
ATGAGCAAGCTTGGATCGAGACGCATATCTTCCATCATCTATCTGCTCGTCTCCAACGTTCTGCTCAACATCTTC
CCGTCGCAACTTGCGGAGGGGAGAAAAAAACCTTCAAATAATAACGTCGTTCGTCATCCCATCATTCACCAACAA
GCCCTGGCCGGTGACCCTGAGAAGGCGCCCCCGGAGGTAAGCTTTGAGCGCAGTCAGTCAGCTCGAGGCACCACC
AACTCGCTTCCCGCGAGACCGCCGGCGTCCTCCAACAGCAAACAGGGCTTCAGGCCGGCCTTTGCCTCGGCTCAG
CCTTTCCAGGCCCCCGGGACATATCCTCCTGGCTCCGCCAACTATTCCGGCGCCGCTGCGAGCAACTATGCCTCT
CCGAGCAACTATCCACCTCGCTCCCACTACGGCGCCTCCGCTCAGTACGGATCCGCTGCTGCATACTCTTCCTCC
TCGTATCCGGGCTACACCGCTTCTGCGCCCGGGGTGAACTCGGCCACACCGGGCTACGGCTACGGCTCGCAGCAG
CAGCCTCAGCACGCTCAGCTGCCGTCGCAACAACAGCAGCCTCCTCAGCAGCCTCCCCAACAGCCGGGCTACGGT
TCCCAGAACGTCAGCGGTTACGCCACCTCGAGCTACGCGCCGCCGCAGATTCAGAACCCCTTCCCCGCGCCGGGC
ACCGCTGCGAGCACCTTCGACCCGTCCGAGGCGGCGCAGATCGCCGAATGGCAGAGCACCTACAACGGCATTCCC
CAAATCAGCCGCGACGGCAAGCCCCTTGGCCTAGTTTCGGAGCCCGCCAAGCCCGACTCTCCGGCCGTGACCGCG
AACCCGGACAAGAAGAAGACGGTGGTGCGCCAGGGCGGCGGCAAGAAATGGACCGACGACACGCTGCTCGAATGG
GACCCGTCCCACCTACGCCTCTTCGTCGGCAACCTCGCTGGTGAGACGACGGACGAATCCCTCCTCAAGGCCTTT
TCCCGCTGGAAGTCGGTACAAAAGGCGCGCGTCATCCGCGACAAGCGCACCACCAAGTCAAAGGGCTACGGCTTC
GTCAGCTTCAGCAACCCGGACGACTTCTTCCAAGCCGCCAAGGAGATGAACGGGAAATACATCCAGAGCCACCCG
GTCGTCGTCCGCAAGGCAAACACCGAGATCAAGGTCTCGAGCGTCAAGGACAAGACAAAGGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGCAAGAACGCCGGCGGCAAGAACAACAACAAGAATAAGAAGAACAACGGTTCCGGAGGCGGA
GGGGGTTCCGTCGTCGCTGGGTACGAGCCCAGTCTCGGTCCCGTCACCGGAGCGGGCGTCACCAAGCCCGGACAG
AAGACCAAGAATGGACTGCGACTCCTGGGCTAG
Gene >Ophio5|8375
ATGAGCAAGCTTGGATCGAGACGCATATCTTCCATCATCTATCTGCTCGTCTCCAACGTGTGTGTTCGAATACCG
GGTTGCGCCGTTCAGGAAGCATGGAGTCGTATTCGTATTCGTACTGTACTGGCTCCTCCGTCAGGCACCGCTGCA
ACAGCGAGCACGTGACTTACTAGCACCCTTCGTCTGACGCAGTCTGCTCAACATCTTCCCGTCGCAACTTGCGGA
GGGGAGAAAAAAACCTTCAAATAATAACGTCGTTCGTCATCCCATCATTCACCAACAAGCCCTGGCCGGTGACCC
TGAGAAGGCGCCCCCGGAGGTAAGCTTTGAGCGCAGTCAGTCAGCTCGAGGTACGTGCCGCACACGCTAGAAGCC
AAAGCCCCCATCGCTCTGGTTGTTTATTATGGCATACGCGCCGCCTCCAGGCACCACCAACTCGCTTCCCGCGAG
ACCGCCGGCGTCCTCCAACAGCAAACAGGGCTTCAGGCCGGCCTTTGCCTCGGCTCAGCCTTTCCAGGCCCCCGG
GACATATCCTCCTGGCTCCGCCAACTATTCCGGCGCCGCTGCGAGCAACTATGCCTCTCCGAGCAACTATCCACC
TCGCTCCCACTACGGCGCCTCCGCTCAGTACGGATCCGCTGCTGCATACTCTTCCTCCTCGTATCCGGGCTACAC
CGCTTCTGCGCCCGGGGTGAACTCGGCCACACCGGGCTACGGCTACGGCTCGCAGCAGCAGCCTCAGCACGCTCA
GCTGCCGTCGCAACAACAGCAGCCTCCTCAGCAGCCTCCCCAACAGCCGGGCTACGGTTCCCAGAACGTCAGCGG
TTACGCCACCTCGAGCTACGCGCCGCCGCAGATTCAGAACCCCTTCCCCGCGCCGGGCACCGCTGCGAGCACCTT
CGACCCGTCCGAGGCGGCGCAGATCGCCGAATGGCAGAGCACCTACAACGGCATTCCCCAAATCAGCCGCGACGG
CAAGCCCCTTGGCCTAGTTTCGGAGCCCGCCAAGCCCGACTCTCCGGCCGTGACCGCGAACCCGGACAAGAAGAA
GACGGTGGTGCGCCAGGGCGGCGGCAAGAAATGGACCGACGACACGCTGCTCGAATGGGACCCGTCCCACCTACG
CCTCTTCGTCGGCAACCTCGCTGGTGAGACGACGGACGAATCCCTCCTCAAGGCCTTTTCCCGCTGGAAGTCGGT
ACAAAAGGCGCGCGTCATCCGCGACAAGCGCACCACCAAGTCAAAGGGCTACGGCTTCGTCAGCTTCAGCAACCC
GGACGACTTCTTCCAAGCCGCCAAGGAGATGAACGGGAAATACATCCAGAGCCACCCGGTCGTCGTCCGCAAGGC
AAACACCGAGATCAAGGTCTCGAGCGTCAAGGACAAGACAAAGGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCAA
GAACGCCGGCGGCAAGAACAACAACAAGAATAAGAAGAACAACGGTTCCGGAGGCGGAGGGGGTTCCGTCGTCGC
TGGGTACGAGCCCAGTCTCGGTCCCGTCACCGGAGCGGGCGTCACCAAGCCCGGACAGAAGACCAAGAATGGACT
GCGACTCCTGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail