Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8373
Gene name
Locationscaffold_92:35252..37449
Strand+
Gene length (bp)2197
Transcript length (bp)2055
Coding sequence length (bp)2052
Protein length (aa) 684

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 3.9E-19 275 589

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 268 605 5.0E-76
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 266 635 2.0E-54
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 264 600 5.0E-43
sp|Q03697|YMD8_YEAST Putative nucleotide-sugar transporter YMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMD8 PE=1 SV=1 277 605 4.0E-42
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 278 600 9.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 268 605 5.0E-76
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 266 635 2.0E-54
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 264 600 5.0E-43
sp|Q03697|YMD8_YEAST Putative nucleotide-sugar transporter YMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMD8 PE=1 SV=1 277 605 4.0E-42
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 278 600 9.0E-41
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 288 597 6.0E-24
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 261 614 1.0E-23
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 265 601 3.0E-22
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 267 614 3.0E-22
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 265 596 8.0E-20
sp|Q9LNH5|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230 OS=Arabidopsis thaliana GN=At1g48230 PE=2 SV=2 288 631 6.0E-19
sp|Q9C8M1|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660 OS=Arabidopsis thaliana GN=At1g53660 PE=3 SV=2 278 589 2.0E-17
sp|Q94EI9|PT314_ARATH Probable sugar phosphate/phosphate translocator At3g14410 OS=Arabidopsis thaliana GN=At3g14410 PE=2 SV=1 277 595 3.0E-17
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 278 592 5.0E-15
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 278 592 2.0E-13
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 278 592 5.0E-12
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 278 592 2.0E-10
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 281 588 2.0E-08
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 272 589 2.0E-08
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 281 589 6.0E-07
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 368 661 3.0E-06
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 424 599 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 271 290 19
2 303 325 22
3 385 407 22
4 414 433 19
5 443 465 22
6 477 499 22
7 514 536 22
8 543 565 22
9 569 591 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8373
MDKEPVTNQPHRPAQSSDYCYLLMTPVMPTAARRPSPTPPFASPPISASTSPSTSSPPVTDSPTTSRYYSAANVS
SSSPRASAVPLPLPRPLTASSPVVPSARQRSGSSSAPQPVSLARFPALGDESSPFVVATATAAASSSSSTCQGRH
LGDDIEMEPVVGHRRRKSSLIHPVGGHRDRLSITIPRDASRSLDDHAVRSADPVKTDSASDSSSDDSDSHLDEEM
GLSSKDRSRRRRSRRRNRRLDNRIAREKDVPVDELREADHDVLRRLVVNGIFILLWYMFSLSISLYNKWMFDRDR
LNFAFPLFTTAMHMLVQFALAGLVLYFVPWLRPQQSHNSDGGRSRHETEPTSSVMSKMFYLTRIGPCGAATGLDI
GLGNASLKFISLTFYTMCKSSSLAFVLLFAFLFRLETPTWRLVAIITVMTMGVILMVFGEVQFKLGGFVLVISAA
FFSGFRWGLTQILLLRNPATSNPFSSIFFLSPVMFVTLLFLAIPVEGFGPLWEGLKTLSAEWGVVMTPLFLLFPG
CIAFLMTASEFALLQRTSVVTLSIAGIFKEVVTISAASVVFQDHLTLINIVGLLTTMAAIVAYNYIKISKMRQDA
QVDVHGRHAEPSPLSPSSPAGSTSEVDADDEAEETAGLLHQPQSQQPDLGPALVTSDGDIQPNLLPPPQQSPIEA
DDNKLGRLD
Coding >Ophio5|8373
ATGGACAAGGAACCAGTCACCAACCAACCTCACCGTCCTGCCCAGTCCTCAGATTACTGCTACCTACTTATGACC
CCCGTGATGCCCACCGCCGCCCGCCGTCCGTCGCCGACTCCCCCTTTCGCCTCTCCGCCCATTTCCGCGTCTACT
TCTCCGTCTACTTCTTCGCCTCCTGTCACTGACTCTCCTACAACGTCTCGTTATTACTCCGCCGCCAACGTCTCT
TCCTCGTCGCCTCGTGCTTCCGCCGTGCCGCTCCCTCTCCCCCGTCCGCTGACCGCCTCGTCGCCCGTTGTTCCG
TCGGCCCGCCAACGCTCCGGCTCGTCGTCGGCGCCTCAGCCCGTCAGCCTCGCTCGATTCCCGGCCCTTGGCGAC
GAATCCTCACCATTCGTCGTCGCCACCGCCACCGCCGCCGCCTCCTCGTCCTCGTCCACGTGCCAGGGTCGCCAC
CTCGGCGACGATATCGAGATGGAGCCCGTCGTGGGCCACCGGCGGCGGAAAAGCAGCCTGATCCATCCCGTAGGC
GGCCACCGCGACCGTCTCTCCATCACCATCCCCCGTGATGCGTCCCGTTCCCTTGACGATCATGCCGTCCGTTCC
GCCGACCCCGTCAAGACCGATTCCGCCAGCGACAGCTCTAGCGACGACTCCGACTCCCACCTGGACGAGGAGATG
GGCCTGTCCAGCAAGGACCGCAGCCGCAGACGGAGGTCGCGTCGGAGGAACAGACGGCTGGATAACCGCATTGCC
AGGGAAAAGGATGTCCCCGTCGATGAGCTGAGAGAGGCAGACCACGACGTTCTGAGACGGCTGGTCGTCAATGGC
ATCTTTATCCTGCTGTGGTACATGTTTTCCTTGTCCATCTCTCTCTACAATAAATGGATGTTTGACCGGGATCGT
CTCAACTTTGCCTTTCCGCTCTTCACCACCGCCATGCATATGCTGGTCCAATTCGCCCTCGCCGGCCTCGTTCTC
TACTTCGTGCCTTGGCTGAGGCCCCAACAGTCGCACAACTCGGACGGCGGCAGGTCGCGGCACGAGACGGAGCCC
ACCAGCTCCGTCATGTCCAAGATGTTCTACCTGACGCGCATTGGGCCCTGCGGTGCCGCGACCGGGCTTGACATT
GGGCTTGGCAACGCCTCGCTCAAGTTTATCAGCCTCACCTTTTACACCATGTGCAAATCATCGTCCCTGGCATTC
GTCCTACTCTTTGCTTTCCTCTTTCGTCTGGAAACGCCTACCTGGCGTCTCGTAGCCATCATTACCGTCATGACC
ATGGGTGTCATCCTCATGGTCTTTGGCGAGGTCCAGTTCAAGCTCGGCGGCTTCGTCCTCGTCATCTCCGCCGCC
TTCTTCTCCGGTTTCCGCTGGGGCCTCACGCAGATCCTGCTACTGCGCAATCCGGCCACGTCGAACCCCTTCTCT
AGCATTTTTTTCCTCTCCCCCGTCATGTTCGTCACCCTCCTTTTCCTCGCCATCCCCGTCGAGGGCTTCGGTCCC
CTTTGGGAGGGGCTCAAGACGTTGAGCGCCGAGTGGGGCGTCGTCATGACGCCGCTCTTCCTCCTCTTCCCCGGC
TGCATCGCTTTCCTCATGACGGCCTCCGAGTTCGCTCTGCTGCAGCGGACTTCCGTCGTCACTCTCTCCATCGCC
GGCATCTTCAAGGAGGTCGTCACCATCTCGGCCGCCTCCGTCGTCTTCCAGGACCATCTGACGCTCATCAACATC
GTCGGCCTCCTCACCACCATGGCCGCCATCGTCGCCTACAACTACATCAAGATCAGCAAAATGCGCCAGGACGCA
CAGGTCGACGTCCACGGGCGGCACGCCGAGCCCAGTCCGCTCTCACCCTCCAGTCCCGCCGGCAGCACGAGCGAA
GTCGACGCAGACGACGAGGCGGAGGAGACGGCTGGCTTGTTGCACCAGCCGCAGTCACAGCAGCCTGACTTGGGT
CCCGCGCTCGTCACCTCGGACGGTGACATTCAGCCCAACTTGCTACCTCCGCCGCAGCAGTCGCCGATTGAGGCC
GACGATAACAAGCTGGGACGCTTGGAT
Transcript >Ophio5|8373
ATGGACAAGGAACCAGTCACCAACCAACCTCACCGTCCTGCCCAGTCCTCAGATTACTGCTACCTACTTATGACC
CCCGTGATGCCCACCGCCGCCCGCCGTCCGTCGCCGACTCCCCCTTTCGCCTCTCCGCCCATTTCCGCGTCTACT
TCTCCGTCTACTTCTTCGCCTCCTGTCACTGACTCTCCTACAACGTCTCGTTATTACTCCGCCGCCAACGTCTCT
TCCTCGTCGCCTCGTGCTTCCGCCGTGCCGCTCCCTCTCCCCCGTCCGCTGACCGCCTCGTCGCCCGTTGTTCCG
TCGGCCCGCCAACGCTCCGGCTCGTCGTCGGCGCCTCAGCCCGTCAGCCTCGCTCGATTCCCGGCCCTTGGCGAC
GAATCCTCACCATTCGTCGTCGCCACCGCCACCGCCGCCGCCTCCTCGTCCTCGTCCACGTGCCAGGGTCGCCAC
CTCGGCGACGATATCGAGATGGAGCCCGTCGTGGGCCACCGGCGGCGGAAAAGCAGCCTGATCCATCCCGTAGGC
GGCCACCGCGACCGTCTCTCCATCACCATCCCCCGTGATGCGTCCCGTTCCCTTGACGATCATGCCGTCCGTTCC
GCCGACCCCGTCAAGACCGATTCCGCCAGCGACAGCTCTAGCGACGACTCCGACTCCCACCTGGACGAGGAGATG
GGCCTGTCCAGCAAGGACCGCAGCCGCAGACGGAGGTCGCGTCGGAGGAACAGACGGCTGGATAACCGCATTGCC
AGGGAAAAGGATGTCCCCGTCGATGAGCTGAGAGAGGCAGACCACGACGTTCTGAGACGGCTGGTCGTCAATGGC
ATCTTTATCCTGCTGTGGTACATGTTTTCCTTGTCCATCTCTCTCTACAATAAATGGATGTTTGACCGGGATCGT
CTCAACTTTGCCTTTCCGCTCTTCACCACCGCCATGCATATGCTGGTCCAATTCGCCCTCGCCGGCCTCGTTCTC
TACTTCGTGCCTTGGCTGAGGCCCCAACAGTCGCACAACTCGGACGGCGGCAGGTCGCGGCACGAGACGGAGCCC
ACCAGCTCCGTCATGTCCAAGATGTTCTACCTGACGCGCATTGGGCCCTGCGGTGCCGCGACCGGGCTTGACATT
GGGCTTGGCAACGCCTCGCTCAAGTTTATCAGCCTCACCTTTTACACCATGTGCAAATCATCGTCCCTGGCATTC
GTCCTACTCTTTGCTTTCCTCTTTCGTCTGGAAACGCCTACCTGGCGTCTCGTAGCCATCATTACCGTCATGACC
ATGGGTGTCATCCTCATGGTCTTTGGCGAGGTCCAGTTCAAGCTCGGCGGCTTCGTCCTCGTCATCTCCGCCGCC
TTCTTCTCCGGTTTCCGCTGGGGCCTCACGCAGATCCTGCTACTGCGCAATCCGGCCACGTCGAACCCCTTCTCT
AGCATTTTTTTCCTCTCCCCCGTCATGTTCGTCACCCTCCTTTTCCTCGCCATCCCCGTCGAGGGCTTCGGTCCC
CTTTGGGAGGGGCTCAAGACGTTGAGCGCCGAGTGGGGCGTCGTCATGACGCCGCTCTTCCTCCTCTTCCCCGGC
TGCATCGCTTTCCTCATGACGGCCTCCGAGTTCGCTCTGCTGCAGCGGACTTCCGTCGTCACTCTCTCCATCGCC
GGCATCTTCAAGGAGGTCGTCACCATCTCGGCCGCCTCCGTCGTCTTCCAGGACCATCTGACGCTCATCAACATC
GTCGGCCTCCTCACCACCATGGCCGCCATCGTCGCCTACAACTACATCAAGATCAGCAAAATGCGCCAGGACGCA
CAGGTCGACGTCCACGGGCGGCACGCCGAGCCCAGTCCGCTCTCACCCTCCAGTCCCGCCGGCAGCACGAGCGAA
GTCGACGCAGACGACGAGGCGGAGGAGACGGCTGGCTTGTTGCACCAGCCGCAGTCACAGCAGCCTGACTTGGGT
CCCGCGCTCGTCACCTCGGACGGTGACATTCAGCCCAACTTGCTACCTCCGCCGCAGCAGTCGCCGATTGAGGCC
GACGATAACAAGCTGGGACGCTTGGATTGA
Gene >Ophio5|8373
ATGGACAAGGAACCAGTCACCAACCAACCTCACCGTCCTGCCCAGTCCTCAGATTACTGCTACCTACTTATGACC
CCCGTGATGCCCACCGCCGCCCGCCGTCCGTCGCCGACTCCCCCTTTCGCCTCTCCGCCCATTTCCGCGTCTACT
TCTCCGTCTACTTCTTCGCCTCCTGTCACTGACTCTCCTACAACGTCTCGTTATTACTCCGCCGCCAACGTCTCT
TCCTCGTCGCCTCGTGCTTCCGCCGTGCCGCTCCCTCTCCCCCGTCCGCTGACCGCCTCGTCGCCCGTTGTTCCG
TCGGCCCGCCAACGCTCCGGCTCGTCGTCGGCGCCTCAGCCCGTCAGCCTCGCTCGATTCCCGGCCCTTGGCGAC
GAATCCTCACCATTCGTCGTCGCCACCGCCACCGCCGCCGCCTCCTCGTCCTCGTCCACGTGCCAGGGTCGCCAC
CTCGGCGACGATATCGAGATGGAGCCCGTCGTGGGCCACCGGCGGCGGAAAAGCAGCCTGATCCATCCCGTAGGC
GGCCACCGCGACCGTCTCTCCATCACCATCCCCCGTGATGCGTCCCGTTCCCTTGACGATCATGCCGTCCGTTCC
GCCGACCCCGTCAAGACCGATTCCGCCAGCGACAGCTCTAGCGACGACTCCGACTCCCACCTGGACGAGGAGATG
GGCCTGTCCAGCAAGGACCGCAGCCGCAGACGGAGGTCGCGTCGGAGGAACAGACGGCTGGATAACCGCATTGCC
AGGGAAAAGGATGTCCCCGTCGATGAGCTGAGAGAGGCAGACCACGACGTTCTGAGACGGCTGGTCGTCAATGGC
ATCTTTATCCTGCTGTGGTACATGTTTTCCTTGTCCATCTCTCTCGTGCGTTACCTCGCCCCCTTTCCCCTTTTT
CTTCACTCCCTTGAGACTCAGCCACTGACAAAAAGACTGGAAATGGCAGTACAATAAATGGATGTTTGACCGGGA
TCGTCTCAACTTTGCCTTTCCGCTCTTCACCACCGCCATGCATATGCTGGTCCAATTCGCCCTCGCCGGCCTCGT
TCTCTACTTCGTGCCTTGGCTGAGGCCCCAACAGTCGCACAACTCGGACGGCGGCAGGTCGCGGCACGAGACGGA
GCCCACCAGCTCCGTCATGTCCAAGATGTTCTACCTGACGCGCATTGGGCCCTGCGGTGCCGCGACCGGGCTTGA
CATTGGGCTTGGCAACGCCTCGCTCAAGTTTATCAGCCTCACCTTTTACAGTCAGTATAAGCCGTCCCTCCCTGT
ACCTCTCATGTCTCCCCTGCTAACCGTAGCGCTTCTAGCCATGTGCAAATCATCGTCCCTGGCATTCGTCCTACT
CTTTGCTTTCCTCTTTCGTCTGGAAACGCCTACCTGGCGTCTCGTAGCCATCATTACCGTCATGACCATGGGTGT
CATCCTCATGGTCTTTGGCGAGGTCCAGTTCAAGCTCGGCGGCTTCGTCCTCGTCATCTCCGCCGCCTTCTTCTC
CGGTTTCCGCTGGGGCCTCACGCAGATCCTGCTACTGCGCAATCCGGCCACGTCGAACCCCTTCTCTAGCATTTT
TTTCCTCTCCCCCGTCATGTTCGTCACCCTCCTTTTCCTCGCCATCCCCGTCGAGGGCTTCGGTCCCCTTTGGGA
GGGGCTCAAGACGTTGAGCGCCGAGTGGGGCGTCGTCATGACGCCGCTCTTCCTCCTCTTCCCCGGCTGCATCGC
TTTCCTCATGACGGCCTCCGAGTTCGCTCTGCTGCAGCGGACTTCCGTCGTCACTCTCTCCATCGCCGGCATCTT
CAAGGAGGTCGTCACCATCTCGGCCGCCTCCGTCGTCTTCCAGGACCATCTGACGCTCATCAACATCGTCGGCCT
CCTCACCACCATGGCCGCCATCGTCGCCTACAACTACATCAAGATCAGCAAAATGCGCCAGGACGCACAGGTCGA
CGTCCACGGGCGGCACGCCGAGCCCAGTCCGCTCTCACCCTCCAGTCCCGCCGGCAGCACGAGCGAAGTCGACGC
AGACGACGAGGCGGAGGAGACGGCTGGCTTGTTGCACCAGCCGCAGTCACAGCAGCCTGACTTGGGTCCCGCGCT
CGTCACCTCGGACGGTGACATTCAGCCCAACTTGCTACCTCCGCCGCAGCAGTCGCCGATTGAGGCCGACGATAA
CAAGCTGGGACGCTTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail