Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8371
Gene name
Locationscaffold_92:29303..30552
Strand+
Gene length (bp)1249
Transcript length (bp)1140
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17683 TFIIF_beta_N TFIIF, beta subunit N-terminus 4.9E-30 47 210
PF02270 TFIIF_beta TFIIF, beta subunit HTH domain 7.6E-28 279 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94424|T2FB_SCHPO Transcription initiation factor IIF subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfg2 PE=1 SV=1 14 343 8.0E-37
sp|P41896|T2FB_YEAST Transcription initiation factor IIF subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFG2 PE=1 SV=2 48 377 3.0E-30
sp|Q03123|T2FB_XENLA General transcription factor IIF subunit 2 OS=Xenopus laevis GN=gtf2f2 PE=2 SV=1 277 349 9.0E-08
sp|Q54KT7|T2FB_DICDI General transcription factor IIF subunit 2 OS=Dictyostelium discoideum GN=gtf2f2 PE=3 SV=2 281 345 2.0E-07
sp|Q2T9L9|T2FB_BOVIN General transcription factor IIF subunit 2 OS=Bos taurus GN=GTF2F2 PE=2 SV=1 271 343 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94424|T2FB_SCHPO Transcription initiation factor IIF subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfg2 PE=1 SV=1 14 343 8.0E-37
sp|P41896|T2FB_YEAST Transcription initiation factor IIF subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFG2 PE=1 SV=2 48 377 3.0E-30
sp|Q03123|T2FB_XENLA General transcription factor IIF subunit 2 OS=Xenopus laevis GN=gtf2f2 PE=2 SV=1 277 349 9.0E-08
sp|Q54KT7|T2FB_DICDI General transcription factor IIF subunit 2 OS=Dictyostelium discoideum GN=gtf2f2 PE=3 SV=2 281 345 2.0E-07
sp|Q2T9L9|T2FB_BOVIN General transcription factor IIF subunit 2 OS=Bos taurus GN=GTF2F2 PE=2 SV=1 271 343 2.0E-06
sp|P13984|T2FB_HUMAN General transcription factor IIF subunit 2 OS=Homo sapiens GN=GTF2F2 PE=1 SV=2 271 349 2.0E-06
sp|Q01750|T2FB_RAT General transcription factor IIF subunit 2 OS=Rattus norvegicus GN=Gtf2f2 PE=1 SV=1 271 343 4.0E-06
sp|Q8R0A0|T2FB_MOUSE General transcription factor IIF subunit 2 OS=Mus musculus GN=Gtf2f2 PE=1 SV=1 271 343 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8371
MADSASFVKPEPEEEKPTLPLEDEDLDEDAGDLEFYDKTTGNHQFETLYLARVPRYMWDAWLKITERLGDDDEIQ
IGTLRTWNQSEVDADGVTRDVTKLRMLLDANCPEHQPLPREYELDVLDRDVQNHFIFSEEDLPSYKARNKARAEA
ASAGIPASLLRQRAQGNGQEHGPQRQSYDRRSRFQPYFRKAIPKKTKMFGKIHYDIRVEPRNVRDEERVLAQKLL
DAEQSKSKLQIISRNSASSIMNPGTAVAAQWGGNFIKNAAQQAKPKKGEVFKAARIPKNQLLDLIFDCFRQYQYW
SMKALRQKLQQPDSYLRQVLEEVAVLHKSGRFANHYGLSDAYKDKAGNDAKEEAAVAADDVDGDGDDDDDEELED
VLPA
Coding >Ophio5|8371
ATGGCGGACTCGGCATCATTCGTCAAGCCCGAACCAGAGGAGGAAAAACCGACGCTGCCGCTTGAGGATGAAGAC
TTGGACGAGGATGCGGGCGACCTGGAGTTCTACGACAAGACGACGGGAAATCACCAATTCGAGACGCTGTATCTC
GCCCGTGTGCCCAGATACATGTGGGATGCCTGGCTGAAGATCACGGAGCGACTGGGCGACGACGACGAGATTCAG
ATCGGCACGCTGCGCACCTGGAACCAGTCCGAGGTCGACGCCGACGGCGTGACGCGCGACGTGACGAAACTGCGA
ATGCTACTGGACGCCAACTGCCCTGAGCACCAGCCGCTACCTCGCGAATACGAGCTTGACGTTCTCGACCGTGAT
GTGCAGAACCACTTCATCTTCAGCGAGGAGGATCTGCCGAGCTACAAGGCCCGCAACAAGGCTCGCGCCGAGGCC
GCCAGCGCTGGAATCCCTGCCTCCTTACTGCGGCAGCGAGCGCAGGGAAACGGCCAGGAGCATGGGCCGCAACGG
CAATCCTACGACCGAAGGAGCCGGTTCCAGCCTTACTTTCGCAAGGCCATCCCAAAGAAGACCAAGATGTTTGGC
AAGATCCACTACGACATACGCGTCGAGCCGCGTAACGTGCGGGATGAAGAGCGTGTACTCGCCCAGAAGCTGTTG
GATGCCGAGCAATCCAAGTCCAAGTTGCAGATCATCAGCCGCAACAGCGCGTCGTCCATTATGAATCCGGGCACC
GCCGTCGCGGCCCAGTGGGGAGGCAATTTCATCAAAAACGCAGCGCAGCAGGCCAAGCCCAAGAAGGGCGAGGTA
TTCAAGGCGGCGCGGATTCCCAAGAACCAACTTCTGGATCTCATCTTCGACTGCTTCCGGCAGTATCAGTATTGG
TCGATGAAGGCGCTCCGTCAAAAGCTGCAGCAGCCCGACTCGTACCTGCGACAGGTGCTGGAAGAGGTGGCGGTG
CTGCATAAGAGCGGGCGCTTCGCCAACCACTACGGACTGAGCGACGCTTACAAGGACAAGGCGGGCAACGACGCC
AAGGAGGAGGCGGCGGTGGCGGCCGACGACGTGGACGGAGATGGCGACGACGACGACGACGAAGAGCTCGAAGAC
GTACTGCCGGCG
Transcript >Ophio5|8371
ATGGCGGACTCGGCATCATTCGTCAAGCCCGAACCAGAGGAGGAAAAACCGACGCTGCCGCTTGAGGATGAAGAC
TTGGACGAGGATGCGGGCGACCTGGAGTTCTACGACAAGACGACGGGAAATCACCAATTCGAGACGCTGTATCTC
GCCCGTGTGCCCAGATACATGTGGGATGCCTGGCTGAAGATCACGGAGCGACTGGGCGACGACGACGAGATTCAG
ATCGGCACGCTGCGCACCTGGAACCAGTCCGAGGTCGACGCCGACGGCGTGACGCGCGACGTGACGAAACTGCGA
ATGCTACTGGACGCCAACTGCCCTGAGCACCAGCCGCTACCTCGCGAATACGAGCTTGACGTTCTCGACCGTGAT
GTGCAGAACCACTTCATCTTCAGCGAGGAGGATCTGCCGAGCTACAAGGCCCGCAACAAGGCTCGCGCCGAGGCC
GCCAGCGCTGGAATCCCTGCCTCCTTACTGCGGCAGCGAGCGCAGGGAAACGGCCAGGAGCATGGGCCGCAACGG
CAATCCTACGACCGAAGGAGCCGGTTCCAGCCTTACTTTCGCAAGGCCATCCCAAAGAAGACCAAGATGTTTGGC
AAGATCCACTACGACATACGCGTCGAGCCGCGTAACGTGCGGGATGAAGAGCGTGTACTCGCCCAGAAGCTGTTG
GATGCCGAGCAATCCAAGTCCAAGTTGCAGATCATCAGCCGCAACAGCGCGTCGTCCATTATGAATCCGGGCACC
GCCGTCGCGGCCCAGTGGGGAGGCAATTTCATCAAAAACGCAGCGCAGCAGGCCAAGCCCAAGAAGGGCGAGGTA
TTCAAGGCGGCGCGGATTCCCAAGAACCAACTTCTGGATCTCATCTTCGACTGCTTCCGGCAGTATCAGTATTGG
TCGATGAAGGCGCTCCGTCAAAAGCTGCAGCAGCCCGACTCGTACCTGCGACAGGTGCTGGAAGAGGTGGCGGTG
CTGCATAAGAGCGGGCGCTTCGCCAACCACTACGGACTGAGCGACGCTTACAAGGACAAGGCGGGCAACGACGCC
AAGGAGGAGGCGGCGGTGGCGGCCGACGACGTGGACGGAGATGGCGACGACGACGACGACGAAGAGCTCGAAGAC
GTACTGCCGGCGTAG
Gene >Ophio5|8371
ATGGCGGACTCGGCATCATTCGTCAAGCCCGAACCAGAGGAGGAAAAACCGACGCTGCCGCTTGAGGATGAAGAC
TTGGACGAGGATGCGGGCGACCTGGAGTTCTACGACAAGACGACGGGAAATCACCAATTCGAGACGCTGTATCTC
GCCCGTGTGCCCAGATACATGTGGGATGCCTGGCTGAAGATCACGGAGCGACTGGGCGACGACGACGAGATTCAG
ATCGGCACGCTGCGCACCTGGAACCAGTCCGAGGTCGACGCCGACGGCGTGACGCGCGACGTGACGAAACTGCGA
ATGCTACTGGACGCCAACTGCCCTGAGCACCAGCCGCTACCTCGCGAATACGAGCTTGACGTTCTCGACCGTGAT
GTGCAGAACCACTTCATCTTCAGCGAGGAGGATCTGCCGAGCTACAAGGCCCGCAACAAGGCTCGCGCCGAGGCC
GCCAGCGCTGGAATCCCTGCCTCCTTACTGCGGCAGCGAGCGCAGGGAAACGGCCAGGAGCATGGGCCGCAACGG
CAATCCTACGACCGAAGGAGCCGGTTCCAGCCTTACTTTCGCAAGGCCATCCCAAGTGAGCTCGTCCTCTGGCAA
TGGGCGAACCGAGGTGCTGACGGGAGCAACACAGAGAAGACCAAGATGTTTGGCAAGATCCACTACGACATACGC
GTCGAGCCGCGTAACGTGCGGGATGAAGAGCGTGTACTCGCCCAGAAGCTGTTGGATGCCGAGCAATCCAAGTCC
AAGTTGCAGATCATCAGCCGCAACAGCGCGTCGTCCATTATGAATCCGGGCACCGCCGTCGCGGCCCAGTGGGGA
GGCAATTTCATCGTAAGCGCGGCTGGGATCTCATTGACTTGGGCTATGCTGACCCGGATGTGTGCAGAAAAACGC
AGCGCAGCAGGCCAAGCCCAAGAAGGGCGAGGTATTCAAGGCGGCGCGGATTCCCAAGAACCAACTTCTGGATCT
CATCTTCGACTGCTTCCGGCAGTATCAGTATTGGTCGATGAAGGCGCTCCGTCAAAAGCTGCAGCAGCCCGACTC
GTACCTGCGACAGGTGCTGGAAGAGGTGGCGGTGCTGCATAAGAGCGGGCGCTTCGCCAACCACTACGGACTGAG
CGACGCTTACAAGGACAAGGCGGGCAACGACGCCAAGGAGGAGGCGGCGGTGGCGGCCGACGACGTGGACGGAGA
TGGCGACGACGACGACGACGAAGAGCTCGAAGACGTACTGCCGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail