Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8368
Gene name
Locationscaffold_92:23945..25031
Strand+
Gene length (bp)1086
Transcript length (bp)933
Coding sequence length (bp)930
Protein length (aa) 310

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01145 Band_7 SPFH domain / Band 7 family 9.0E-25 56 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50085|PHB2_YEAST Prohibitin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB2 PE=1 SV=2 4 296 4.0E-134
sp|O94550|PHB2_SCHPO Prohibitin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb2 PE=1 SV=2 53 296 2.0E-124
sp|Q9ZNT7|PHB2_ARATH Prohibitin-2, mitochondrial OS=Arabidopsis thaliana GN=PHB2 PE=1 SV=1 26 283 2.0E-103
sp|O49460|PHB1_ARATH Prohibitin-1, mitochondrial OS=Arabidopsis thaliana GN=PHB1 PE=1 SV=1 52 283 4.0E-102
sp|Q54Q31|PHB2_DICDI Prohibitin-2 OS=Dictyostelium discoideum GN=phbB PE=3 SV=1 53 299 6.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50085|PHB2_YEAST Prohibitin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB2 PE=1 SV=2 4 296 4.0E-134
sp|O94550|PHB2_SCHPO Prohibitin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb2 PE=1 SV=2 53 296 2.0E-124
sp|Q9ZNT7|PHB2_ARATH Prohibitin-2, mitochondrial OS=Arabidopsis thaliana GN=PHB2 PE=1 SV=1 26 283 2.0E-103
sp|O49460|PHB1_ARATH Prohibitin-1, mitochondrial OS=Arabidopsis thaliana GN=PHB1 PE=1 SV=1 52 283 4.0E-102
sp|Q54Q31|PHB2_DICDI Prohibitin-2 OS=Dictyostelium discoideum GN=phbB PE=3 SV=1 53 299 6.0E-102
sp|Q5XIH7|PHB2_RAT Prohibitin-2 OS=Rattus norvegicus GN=Phb2 PE=1 SV=1 20 306 7.0E-100
sp|O35129|PHB2_MOUSE Prohibitin-2 OS=Mus musculus GN=Phb2 PE=1 SV=1 36 306 1.0E-99
sp|Q99623|PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 36 306 1.0E-99
sp|Q2HJ97|PHB2_BOVIN Prohibitin-2 OS=Bos taurus GN=PHB2 PE=2 SV=1 20 306 3.0E-99
sp|A9UMS3|PHB2_XENTR Prohibitin-2 OS=Xenopus tropicalis GN=phb2 PE=2 SV=1 20 306 3.0E-99
sp|Q5RB19|PHB2_PONAB Prohibitin-2 OS=Pongo abelii GN=PHB2 PE=2 SV=1 32 306 1.0E-98
sp|Q9SIL6|PHB6_ARATH Prohibitin-6, mitochondrial OS=Arabidopsis thaliana GN=PHB6 PE=1 SV=1 15 283 1.0E-98
sp|P50093|PHB2_CAEEL Mitochondrial prohibitin complex protein 2 OS=Caenorhabditis elegans GN=phb-2 PE=1 SV=2 53 300 9.0E-98
sp|Q5ZMN3|PHB2_CHICK Prohibitin-2 OS=Gallus gallus GN=PHB2 PE=2 SV=1 53 297 1.0E-95
sp|Q9FFH5|PHB7_ARATH Prohibitin-7, mitochondrial OS=Arabidopsis thaliana GN=PHB7 PE=1 SV=1 33 293 4.0E-95
sp|Q9P7H3|PHB1_SCHPO Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb1 PE=3 SV=1 46 308 3.0E-90
sp|P84173|PHB_CHICK Prohibitin OS=Gallus gallus GN=PHB PE=1 SV=1 35 280 2.0E-89
sp|P67779|PHB_RAT Prohibitin OS=Rattus norvegicus GN=Phb PE=1 SV=1 35 280 4.0E-89
sp|P67778|PHB_MOUSE Prohibitin OS=Mus musculus GN=Phb PE=1 SV=1 35 280 4.0E-89
sp|P35232|PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 35 280 1.0E-88
sp|Q3T165|PHB_BOVIN Prohibitin OS=Bos taurus GN=PHB PE=2 SV=1 35 280 1.0E-88
sp|Q54GI9|PHB1_DICDI Prohibitin-1, mitochondrial OS=Dictyostelium discoideum GN=phbA PE=3 SV=1 46 280 5.0E-88
sp|P24156|L2CC_DROME Protein l(2)37Cc OS=Drosophila melanogaster GN=l(2)37Cc PE=2 SV=2 35 280 1.0E-86
sp|P40961|PHB1_YEAST Prohibitin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB1 PE=1 SV=2 38 280 2.0E-86
sp|O04331|PHB3_ARATH Prohibitin-3, mitochondrial OS=Arabidopsis thaliana GN=PHB3 PE=1 SV=1 38 280 1.0E-83
sp|Q9LK25|PHB4_ARATH Prohibitin-4, mitochondrial OS=Arabidopsis thaliana GN=PHB4 PE=1 SV=1 38 280 2.0E-82
sp|Q9BKU4|PHB1_CAEEL Mitochondrial prohibitin complex protein 1 OS=Caenorhabditis elegans GN=phb-1 PE=1 SV=1 35 285 8.0E-77
sp|Q9LY99|PHB5_ARATH Prohibitin-5, mitochondrial OS=Arabidopsis thaliana GN=PHB5 PE=3 SV=1 52 280 4.0E-59
sp|P86220|PHB_MESAU Prohibitin (Fragments) OS=Mesocricetus auratus GN=PHB PE=1 SV=1 111 223 3.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8368
MSNWQDEAMRAMQRLRRMQMNNGGGGGPSPQRAMMGVLGMGVLMGGSVLLYNSLFNVDGGHRAIKYRRLGGVSKE
IYNEGTHINIPWFETPIMYDVRARPRNVASLTGTKDLQMVNITCRVLSRPQIDALPQIYRTLGADYDERVLPSIV
NEVLKSVVAQFNASQLITQRDMVAKLVRENLSRRAARFNIMLDDVSLTHLTFSPEFTAAVEAKQVAQQEAQRAAF
VVDKARQEKQAMVVKAQGEARSAELIGEAIKKNQAYAELKKIENARLIAQQLQDSGAKNRLLLDAEGLGLNVFES
SSSSSSSGKT
Coding >Ophio5|8368
ATGAGTAATTGGCAAGATGAGGCGATGCGGGCGATGCAACGCCTGCGCCGAATGCAGATGAACAACGGCGGAGGA
GGCGGACCCAGTCCGCAGCGAGCCATGATGGGCGTCTTGGGCATGGGCGTCCTCATGGGCGGAAGTGTCCTGCTG
TATAACTCGCTTTTCAACGTCGATGGTGGTCACCGGGCCATCAAGTATCGGAGGTTGGGCGGCGTGAGCAAGGAG
ATTTACAACGAAGGAACGCACATCAATATCCCCTGGTTCGAGACGCCCATCATGTACGACGTGCGAGCGCGGCCG
CGCAACGTGGCGTCCCTGACGGGCACCAAGGACCTTCAGATGGTCAACATCACCTGCCGCGTGCTGTCGAGACCG
CAGATCGACGCGCTGCCGCAGATCTACCGCACGTTGGGCGCCGACTATGACGAGAGGGTGCTTCCGTCCATCGTC
AACGAGGTGCTGAAGAGCGTCGTTGCGCAATTCAATGCAAGCCAGCTTATCACGCAGCGTGACATGGTGGCCAAG
CTCGTGCGCGAGAATCTGTCGCGCCGAGCTGCGCGCTTCAACATTATGCTCGACGACGTGTCCCTGACGCATCTT
ACCTTCTCGCCCGAGTTCACGGCCGCCGTCGAGGCCAAACAGGTGGCGCAGCAGGAGGCGCAGCGGGCGGCCTTT
GTCGTCGACAAGGCGCGACAGGAGAAACAGGCCATGGTGGTCAAGGCACAGGGTGAGGCGCGGTCGGCGGAGCTC
ATCGGCGAGGCTATCAAGAAGAACCAGGCCTACGCGGAGCTCAAGAAGATTGAGAACGCGCGGCTCATCGCGCAG
CAGCTTCAGGACTCGGGTGCCAAGAACAGGCTGCTACTGGATGCTGAGGGCCTGGGCCTCAACGTCTTTGAGTCG
TCGTCGTCGTCGTCGTCATCGGGAAAGACT
Transcript >Ophio5|8368
ATGAGTAATTGGCAAGATGAGGCGATGCGGGCGATGCAACGCCTGCGCCGAATGCAGATGAACAACGGCGGAGGA
GGCGGACCCAGTCCGCAGCGAGCCATGATGGGCGTCTTGGGCATGGGCGTCCTCATGGGCGGAAGTGTCCTGCTG
TATAACTCGCTTTTCAACGTCGATGGTGGTCACCGGGCCATCAAGTATCGGAGGTTGGGCGGCGTGAGCAAGGAG
ATTTACAACGAAGGAACGCACATCAATATCCCCTGGTTCGAGACGCCCATCATGTACGACGTGCGAGCGCGGCCG
CGCAACGTGGCGTCCCTGACGGGCACCAAGGACCTTCAGATGGTCAACATCACCTGCCGCGTGCTGTCGAGACCG
CAGATCGACGCGCTGCCGCAGATCTACCGCACGTTGGGCGCCGACTATGACGAGAGGGTGCTTCCGTCCATCGTC
AACGAGGTGCTGAAGAGCGTCGTTGCGCAATTCAATGCAAGCCAGCTTATCACGCAGCGTGACATGGTGGCCAAG
CTCGTGCGCGAGAATCTGTCGCGCCGAGCTGCGCGCTTCAACATTATGCTCGACGACGTGTCCCTGACGCATCTT
ACCTTCTCGCCCGAGTTCACGGCCGCCGTCGAGGCCAAACAGGTGGCGCAGCAGGAGGCGCAGCGGGCGGCCTTT
GTCGTCGACAAGGCGCGACAGGAGAAACAGGCCATGGTGGTCAAGGCACAGGGTGAGGCGCGGTCGGCGGAGCTC
ATCGGCGAGGCTATCAAGAAGAACCAGGCCTACGCGGAGCTCAAGAAGATTGAGAACGCGCGGCTCATCGCGCAG
CAGCTTCAGGACTCGGGTGCCAAGAACAGGCTGCTACTGGATGCTGAGGGCCTGGGCCTCAACGTCTTTGAGTCG
TCGTCGTCGTCGTCGTCATCGGGAAAGACTTAG
Gene >Ophio5|8368
ATGAGTAATTGGCAAGATGAGGCGATGCGGGCGATGCAACGCCTGCGCCGAATGCAGATGAACAACGGCGGAGGA
GGCGGACCCAGTCCGCAGCGAGCCATGATGGGCGTCTTGGGCATGGGCGTCCTCATGGGCGGAAGTGTCCTGCTG
TATAACTCGCTTTTCAACGTCGATGGTGGTCACCGGGCCATCAAGTATCGGAGGTTGGGCGGCGTGAGCAAGGAG
ATTTACAACGAAGGTGGACCATTACCTCGAGAAGCAGAAAAGAAAGAGATAGGGGAGGGCTAATCGACGTCGGCA
GGAACGCACATCAATATCCCCTGGTTCGAGACGCCCATCATGTACGACGTGCGAGCGCGGCCGCGCAACGTGGCG
TCCCTGACGGGCACCAAGGACCTTCAGATGGTCAACATCACCTGCCGCGTGCTGTCGAGACCGCAGATCGACGCG
CTGCCGCAGATCTACCGCACGTTGGGCGCCGACTATGACGAGAGGGTGCTTCCGTCCATCGTCAACGAGGTGCTG
AAGAGCGTCGTTGCGCAATTCAATGCAAGCCAGCTTATCACGCAGCGTGACATGGTGGCCAAGCTCGTGCGCGAG
AATCTGTCGCGCCGAGCTGCGCGCTTCAACATTATGCTCGACGACGTGTCCCTGACGGTATTTTCCCCCGACCCT
TAAAAATCCGTTTGTTTCTGGCGGTTCGTCTCCCACAAGCGCGCGGCTAACGGTGACATGTTTGGTTTCTAGCAT
CTTACCTTCTCGCCCGAGTTCACGGCCGCCGTCGAGGCCAAACAGGTGGCGCAGCAGGAGGCGCAGCGGGCGGCC
TTTGTCGTCGACAAGGCGCGACAGGAGAAACAGGCCATGGTGGTCAAGGCACAGGGTGAGGCGCGGTCGGCGGAG
CTCATCGGCGAGGCTATCAAGAAGAACCAGGCCTACGCGGAGCTCAAGAAGATTGAGAACGCGCGGCTCATCGCG
CAGCAGCTTCAGGACTCGGGTGCCAAGAACAGGCTGCTACTGGATGCTGAGGGCCTGGGCCTCAACGTCTTTGAG
TCGTCGTCGTCGTCGTCGTCATCGGGAAAGACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail