Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8362
Gene name
Locationscaffold_92:13350..14065
Strand-
Gene length (bp)715
Transcript length (bp)411
Coding sequence length (bp)408
Protein length (aa) 136

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4 1.6E-19 34 120

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74825|RPB4_SCHPO DNA-directed RNA polymerase II subunit rpb4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb4 PE=1 SV=1 17 127 2.0E-21
sp|Q9VEA5|RPB4_DROME DNA-directed RNA polymerase II 16 kDa polypeptide OS=Drosophila melanogaster GN=Rpb4 PE=2 SV=5 6 127 8.0E-12
sp|P20433|RPB4_YEAST DNA-directed RNA polymerase II subunit RPB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB4 PE=1 SV=1 63 127 5.0E-11
sp|Q9D7M8|RPB4_MOUSE DNA-directed RNA polymerase II subunit RPB4 OS=Mus musculus GN=Polr2d PE=1 SV=2 12 127 2.0E-10
sp|O15514|RPB4_HUMAN DNA-directed RNA polymerase II subunit RPB4 OS=Homo sapiens GN=POLR2D PE=1 SV=1 12 127 2.0E-10

GO

GO Term Description Terminal node
GO:0006352 DNA-templated transcription, initiation Yes
GO:0030880 RNA polymerase complex Yes
GO:0046483 heterocycle metabolic process No
GO:0061695 transferase complex, transferring phosphorus-containing groups No
GO:1990234 transferase complex No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1902494 catalytic complex No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0009987 cellular process No
GO:0032774 RNA biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0140535 intracellular protein-containing complex No
GO:0009059 macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0016070 RNA metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6172 0.6301 0.1478 0.0461 0.1465 0.0043 0.0396 0.0383 0.0552 0.068

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1928
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6120
Ophiocordyceps australis map64 (Brazil) OphauB2|7774
Ophiocordyceps camponoti-floridani Ophcf2|07319
Ophiocordyceps camponoti-rufipedis Ophun1|4439
Ophiocordyceps kimflemingae Ophio5|8362 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2059

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8362
MSTNKMSRPKPPPPGNEEASATLNLGEFQNVDTLTLSEAALVLNALVTKRRNDRKNVNETEMLSQTINYLDHFAR
FTQKENVEAVERLLSSHKDLAKFERAQLGSLCCENADEAKTLIPPFSLRPQDLFHFSCHFT
Coding >Ophio5|8362
ATGTCGACCAACAAGATGTCGCGCCCGAAGCCGCCGCCGCCCGGAAACGAGGAGGCTTCGGCGACGCTGAACCTG
GGCGAGTTCCAAAACGTCGACACGCTGACGCTGTCCGAGGCGGCCCTGGTTCTCAATGCCCTCGTTACCAAGCGT
CGAAACGATCGTAAAAATGTGAATGAAACTGAAATGCTGAGCCAGACAATAAACTATCTCGATCACTTCGCGCGC
TTCACACAAAAGGAAAACGTCGAGGCCGTCGAGCGGCTACTCAGCTCGCACAAGGACCTGGCTAAGTTTGAGCGG
GCACAACTCGGTTCCTTGTGCTGCGAAAACGCCGACGAAGCCAAGACACTCATCCCGCCATTCTCTTTACGCCCA
CAAGACTTGTTTCATTTTTCTTGTCATTTTACA
Transcript >Ophio5|8362
ATGTCGACCAACAAGATGTCGCGCCCGAAGCCGCCGCCGCCCGGAAACGAGGAGGCTTCGGCGACGCTGAACCTG
GGCGAGTTCCAAAACGTCGACACGCTGACGCTGTCCGAGGCGGCCCTGGTTCTCAATGCCCTCGTTACCAAGCGT
CGAAACGATCGTAAAAATGTGAATGAAACTGAAATGCTGAGCCAGACAATAAACTATCTCGATCACTTCGCGCGC
TTCACACAAAAGGAAAACGTCGAGGCCGTCGAGCGGCTACTCAGCTCGCACAAGGACCTGGCTAAGTTTGAGCGG
GCACAACTCGGTTCCTTGTGCTGCGAAAACGCCGACGAAGCCAAGACACTCATCCCGCCATTCTCTTTACGCCCA
CAAGACTTGTTTCATTTTTCTTGTCATTTTACATAA
Gene >Ophio5|8362
ATGTCGACCAACAAGATGTCGCGCCCGAAGCCGCCGCCGCCCGGAAACGAGGAGGCTTCGGCGACGCTGAACCTG
GGCGAGTTCCAAAACGTCGACACGCTGACGCTGTCCGAGGCGGCCCTGGTTCTCAATGCCCTCGTTACCAAGCGT
CGAAACGATCGTAAAAATGTGAATGAAACTGAGTCTGTCTCTCCCACCCTCCTTCTATCAATTCGCTGTATTGCT
TCTCATCTCATTCCTTCTTTTGTTGATCTTTTTTTCCCTCGCAGAATGCTGAGCCAGACAATAAACTATCTCGAT
CACTTCGCGCGCTTCACACAAAAGGAAAACGTCGAGGCCGTCGAGCGGCTACTCAGCTCGCACAAGGACCTGGCT
AAGTTTGAGCGGGCACAACTCGGTCTGTCGGCCTATCACCGTATCGAGCCAGACTCTGTGCAAGTCACTGACCTG
TTCGTCTTTGGCAGGTTCCTTGTGCTGCGAAAACGCCGACGAAGCCAAGACACTCATCCCGTCCCTGGCCGATAA
GATCAAGGACGAGGACCTGCAGGAGCTCCTCGATGAAATTTCTAAGCTACAAAACCGATGACCCCAGCTCGGCCG
CCTGAGGCCATTCTCTTTACGCCCGTATGTTGTGTCGTTGAGCTTCAGCCTTTTGCATGCCATTGACGACTCTAT
CAGACAAGACTTGTTTCATTTTTCTTGTCATTTTACATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail