Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8355
Gene name
Locationscaffold_917:967..5560
Strand+
Gene length (bp)4593
Transcript length (bp)4455
Coding sequence length (bp)4452
Protein length (aa) 1484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20168 PDS5 Sister chromatid cohesion protein PDS5 protein 0.0E+00 71 1256

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFF5|PDS5_SCHPO Sister chromatid cohesion protein pds5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pds5 PE=1 SV=1 53 1288 2.0E-144
sp|Q04264|PDS5_YEAST Sister chromatid cohesion protein PDS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDS5 PE=1 SV=1 53 1311 8.0E-120
sp|Q5F3V3|PDS5A_CHICK Sister chromatid cohesion protein PDS5 homolog A OS=Gallus gallus GN=PDS5A PE=2 SV=2 67 1231 5.0E-47
sp|Q4VA53|PDS5B_MOUSE Sister chromatid cohesion protein PDS5 homolog B OS=Mus musculus GN=Pds5b PE=1 SV=1 67 1278 7.0E-47
sp|Q9NTI5|PDS5B_HUMAN Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens GN=PDS5B PE=1 SV=1 67 1278 8.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFF5|PDS5_SCHPO Sister chromatid cohesion protein pds5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pds5 PE=1 SV=1 53 1288 2.0E-144
sp|Q04264|PDS5_YEAST Sister chromatid cohesion protein PDS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDS5 PE=1 SV=1 53 1311 8.0E-120
sp|Q5F3V3|PDS5A_CHICK Sister chromatid cohesion protein PDS5 homolog A OS=Gallus gallus GN=PDS5A PE=2 SV=2 67 1231 5.0E-47
sp|Q4VA53|PDS5B_MOUSE Sister chromatid cohesion protein PDS5 homolog B OS=Mus musculus GN=Pds5b PE=1 SV=1 67 1278 7.0E-47
sp|Q9NTI5|PDS5B_HUMAN Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens GN=PDS5B PE=1 SV=1 67 1278 8.0E-47
sp|Q6TRW4|PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus GN=Pds5b PE=1 SV=2 67 1278 2.0E-46
sp|Q5U241|PD5BB_XENLA Sister chromatid cohesion protein PDS5 homolog B-B OS=Xenopus laevis GN=pds5b-b PE=2 SV=2 67 1278 4.0E-46
sp|Q5F3U9|PDS5B_CHICK Sister chromatid cohesion protein PDS5 homolog B OS=Gallus gallus GN=PDS5B PE=2 SV=3 67 1278 1.0E-45
sp|Q4QXM3|PD5AA_XENLA Sister chromatid cohesion protein PDS5 homolog A-A OS=Xenopus laevis GN=pds5a-a PE=1 SV=1 67 1231 4.0E-44
sp|Q4KLU7|PD5AB_XENLA Sister chromatid cohesion protein PDS5 homolog A-B OS=Xenopus laevis GN=pds5a-b PE=1 SV=1 67 1231 4.0E-44
sp|A1L1F4|PDS5A_DANRE Sister chromatid cohesion protein PDS5 homolog A OS=Danio rerio GN=pds5a PE=2 SV=1 72 1231 3.0E-43
sp|Q498H0|PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis GN=pds5b-a PE=1 SV=1 67 1278 5.0E-43
sp|A4L9P7|PDS5A_RAT Sister chromatid cohesion protein PDS5 homolog A OS=Rattus norvegicus GN=Pds5a PE=1 SV=1 67 618 1.0E-22
sp|Q6A026|PDS5A_MOUSE Sister chromatid cohesion protein PDS5 homolog A OS=Mus musculus GN=Pds5a PE=1 SV=3 67 618 1.0E-22
sp|Q29RF7|PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens GN=PDS5A PE=1 SV=1 67 618 2.0E-22
sp|Q29RF7|PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens GN=PDS5A PE=1 SV=1 895 1231 8.0E-22
sp|A4L9P7|PDS5A_RAT Sister chromatid cohesion protein PDS5 homolog A OS=Rattus norvegicus GN=Pds5a PE=1 SV=1 895 1231 1.0E-21
sp|Q6A026|PDS5A_MOUSE Sister chromatid cohesion protein PDS5 homolog A OS=Mus musculus GN=Pds5a PE=1 SV=3 895 1231 2.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8355
MPRRRARRQEPAEDADDDDEQQVRNGSAEPHTPESHKQPERGSADDEDELPILRFDEELSWRPAKPIPSATLVAR
LEKLSKELAEFDQGEVQLDSLRSVAAHLAHRNLLQHKDRGVKAYTACCLVDILRLFVPDAPFTDDQLKMMFSLFV
KDILPALHDSTNPYNSQHKYVLVSLTDVKSILLISDLDGADDLLLRLFNSAFDGVSASSKASAGEQVAQDVEILL
AEMLMELIDESPGSIPATVIDAIISQFLRAAPPGGGGGGGRHKDVNGKQSTLLRKTEPPAYVMAKSICNGCADKM
SRYVSQYFSDVILNASGFATKANNHRQDDDSDEEDANAGPSDADLKSLRQAHLLIRELWRAAPDILQNVVPQLDA
ELSADNVHLRLIATETFGDMISGIGAAGPPAPPTLDPTAYPQLRLMDEIPPEPVEINVLTKPCSPQSFAQTHAGT
YRNFIGRKNDKAGPIRAAWVTAAGYILSTSAGGIGLSREEEAELVRGLGEKLNDSEEKVRLAAVNAIELFGFRDV
VSKLGATGGVDKEGSVFASLADRCRDRKPAVRVDAMVLLGKLWAVGAGEIADGQEAVTACLSGVPSRIINAFYAN
DPDLNILLDRVMFECLVPLKYPSIKKSAKSASQSQSSKGSVGPADQDRLRAERILLMLKFLDTAAQKAFFAMQAR
QPQFAQGVAIFIQQCEAYNGGVVDVNEEKVKASLVKTFQWLGASFPDPLKVRADLQKFAKLNDRRGYQLVKYAIE
SESDFKTVRRAIHELITKIQASSASGCLDTLIPLLYRSSCLMFNRSHLATIMDYSKSDKNGFAGVAHQVLNDISQ
RNPDIFKAHVGELHKEITEQAPTDKRTNDAAVADILKAYSSYSKRYPRDINCNKAFTQTLVNYALYGSPPKSAKY
AVNILLARDDDRSKVTATNLLRSAVKDLDYGTPHFLARLAAISQLERLAPTVAADSDEDIHDLTIKKILREVRTE
AKADSDPTWVQDVDMDQELQAKCLSLRILVNRAMATAEEPEAEERVKPVFKLLRTLVVAEGEFCKTKDTPSHHKK
RLRLLAGLLTLKLCTVKAYDEQLEPISFNKLAELVQDSELQVRRRFMEKLQGYLTRGRLRARFHTILFLAAFEPV
TELKNRMETWIRSRARYYEEKKQQIMEATMGRLIPLLAHHPDYTSDVDDLTDFANYFLFYLGTVATEGNISLIYK
YAERVKQTRDALSPDGSDNLYVLSDLAQTVIRKYQERRNWSFQAWPGKVGLPAGLYVGLPSSEVAQQIAKKQYIP
DELDERLDDVMRALDRKKKRKSMNEANEPPAKRTKTPVKTAAIRDRSERKPKAAAKKASSKAKSASRPKKQTRPC
PPVPAAERRRSSRAHKVSDYKERDDADDEQEMLDGVAVWDYEEDDSSEAEREPDGSDEASDDDDDDDGDDGDDGA
GSVSEEGEEAPTRSNRKSAPVKNKAKAAGGNGRIGRAQGRRMAKGSSDRDDNDDDDDDE
Coding >Ophio5|8355
ATGCCGCGTCGTCGCGCGCGTCGCCAGGAGCCCGCCGAAGATGCGGACGACGACGACGAACAACAGGTTCGCAAC
GGATCCGCCGAGCCTCATACGCCCGAGTCACATAAGCAGCCTGAACGAGGCAGCGCAGATGATGAAGACGAGCTG
CCCATCTTGCGCTTCGACGAGGAGCTCTCCTGGCGGCCTGCCAAGCCCATTCCCAGCGCCACCCTCGTCGCTCGG
CTCGAGAAGCTATCCAAGGAACTGGCCGAATTCGATCAGGGCGAGGTCCAGCTTGATTCTCTGCGCTCCGTCGCT
GCTCACCTTGCCCATCGCAACCTGCTGCAGCACAAGGACCGCGGCGTCAAGGCATACACGGCCTGCTGCCTGGTC
GACATTCTGCGCCTCTTCGTCCCGGACGCTCCCTTCACCGACGATCAGCTCAAGATGATGTTTTCACTCTTCGTC
AAGGACATCCTGCCCGCCTTGCACGACTCTACCAACCCGTACAACAGCCAGCACAAATACGTCCTCGTCTCCTTG
ACCGATGTCAAGAGTATCCTTCTCATCTCCGATCTTGACGGAGCCGACGACCTCTTGCTGCGCCTCTTCAACTCG
GCCTTTGACGGCGTCTCGGCTAGCTCAAAGGCCTCGGCCGGCGAGCAGGTCGCCCAGGACGTCGAGATCCTACTG
GCCGAGATGCTCATGGAGCTCATCGACGAGTCGCCTGGCAGTATTCCGGCTACCGTAATCGACGCCATCATCAGT
CAGTTTCTGCGCGCCGCTCCGCCCGGCGGCGGCGGCGGCGGCGGTCGCCACAAGGACGTCAATGGCAAGCAGTCG
ACACTCCTCCGCAAGACGGAACCTCCGGCCTATGTCATGGCCAAGAGCATCTGCAACGGCTGCGCCGACAAGATG
TCGCGCTACGTGAGCCAGTACTTTAGCGACGTCATCCTCAATGCCTCGGGCTTTGCCACCAAGGCAAACAACCAC
CGGCAAGACGACGACTCGGACGAAGAAGACGCCAACGCGGGACCGTCTGATGCCGATCTCAAGAGCCTTCGCCAG
GCCCATCTGCTCATCCGAGAGCTCTGGCGCGCCGCCCCTGACATCCTGCAGAACGTCGTGCCCCAGTTGGACGCT
GAGCTGTCTGCCGACAACGTCCATCTGCGACTGATTGCGACGGAGACGTTTGGCGACATGATCTCGGGCATCGGT
GCCGCCGGTCCTCCTGCTCCGCCGACTCTGGATCCCACTGCCTATCCCCAGCTGCGCCTGATGGACGAGATCCCC
CCGGAACCGGTCGAGATCAACGTTCTGACCAAGCCCTGCTCGCCGCAGTCCTTTGCTCAGACGCACGCCGGGACG
TACCGCAACTTTATCGGCCGCAAGAATGACAAGGCGGGCCCGATTCGGGCGGCTTGGGTCACCGCCGCGGGCTAC
ATCCTATCCACCTCGGCCGGTGGCATCGGCCTCAGCAGAGAGGAAGAGGCCGAACTCGTCAGGGGGCTCGGGGAG
AAGCTCAACGACAGCGAGGAGAAGGTGCGGCTCGCGGCAGTCAATGCCATCGAGCTCTTCGGCTTCCGCGACGTC
GTCTCCAAGCTTGGCGCCACCGGCGGCGTCGACAAGGAGGGCTCCGTCTTTGCCAGCTTGGCGGACAGATGCCGC
GACAGGAAACCAGCCGTGCGCGTCGACGCCATGGTCCTCCTCGGGAAGCTGTGGGCTGTGGGCGCCGGCGAGATT
GCCGACGGACAGGAGGCCGTGACGGCCTGTCTTTCGGGCGTGCCGTCGCGCATCATCAATGCCTTCTACGCCAAC
GACCCCGACCTCAACATTCTCCTCGACAGGGTCATGTTCGAGTGTCTCGTGCCCCTCAAGTACCCGTCCATCAAG
AAGTCGGCCAAGAGCGCGTCCCAGTCCCAGAGCAGCAAGGGCAGCGTCGGACCGGCGGATCAGGACAGGCTACGG
GCCGAGCGAATCCTTCTCATGCTCAAGTTCCTCGACACCGCCGCTCAAAAGGCCTTTTTCGCCATGCAGGCGCGG
CAGCCTCAGTTCGCCCAGGGCGTCGCCATCTTCATCCAGCAGTGCGAGGCGTACAACGGCGGCGTCGTCGACGTC
AACGAGGAAAAGGTCAAGGCGAGCCTGGTCAAGACGTTTCAGTGGCTCGGCGCCTCGTTTCCCGACCCGCTCAAA
GTGCGTGCCGATCTCCAAAAGTTCGCAAAGCTCAACGATCGCCGCGGCTACCAGCTGGTCAAGTACGCGATTGAG
TCGGAGAGCGACTTCAAGACGGTCCGGAGAGCCATCCACGAGCTCATCACCAAGATCCAGGCGAGCTCGGCCTCG
GGCTGTCTGGATACGCTGATTCCCCTCCTCTACCGGTCCAGCTGCCTCATGTTCAACCGCAGCCATCTGGCGACG
ATCATGGACTACTCCAAGAGCGACAAGAACGGCTTCGCCGGCGTCGCCCATCAAGTGCTCAACGACATATCGCAA
CGGAATCCAGACATCTTCAAGGCTCACGTCGGGGAGCTGCACAAGGAGATTACCGAGCAGGCGCCGACGGACAAG
AGGACCAACGATGCGGCCGTGGCGGACATTCTCAAGGCCTACTCGTCCTACTCGAAGCGATACCCGCGCGACATC
AACTGCAACAAGGCCTTCACCCAGACTCTCGTCAACTACGCGCTCTATGGATCGCCCCCCAAGTCTGCCAAATAC
GCAGTCAACATCCTCCTTGCCAGAGACGACGACCGAAGCAAGGTCACGGCCACCAATCTCCTGAGGAGCGCTGTC
AAGGACTTGGATTACGGCACGCCGCACTTTCTCGCCCGGCTGGCCGCCATCAGCCAGCTCGAGCGCCTCGCGCCC
ACCGTCGCTGCCGACTCGGACGAGGATATACACGATTTGACCATCAAGAAGATCCTGCGCGAAGTGCGGACCGAG
GCAAAGGCTGATTCTGACCCTACCTGGGTTCAGGACGTTGACATGGACCAGGAGCTCCAGGCAAAGTGTCTGTCG
CTCCGGATATTGGTCAACCGGGCCATGGCCACGGCCGAGGAGCCGGAGGCCGAGGAACGGGTGAAGCCGGTCTTT
AAGCTGCTCAGGACCTTGGTCGTCGCCGAGGGGGAGTTTTGCAAAACCAAGGACACTCCGTCGCACCACAAGAAG
CGGCTGCGGCTACTGGCGGGCTTGCTGACGCTGAAACTGTGTACGGTGAAGGCGTACGATGAGCAGCTTGAGCCC
ATCAGCTTCAACAAGCTCGCGGAGCTTGTTCAGGACAGCGAGCTCCAGGTCCGTCGGCGCTTCATGGAGAAGCTG
CAGGGCTATCTGACCCGAGGCAGGCTGCGGGCAAGATTCCACACCATCTTGTTCCTGGCCGCCTTTGAGCCCGTG
ACGGAGCTCAAGAACCGGATGGAGACGTGGATCCGGTCTCGGGCTCGTTACTACGAGGAAAAGAAGCAGCAGATT
ATGGAGGCTACCATGGGGAGACTGATTCCTCTGCTGGCGCACCACCCGGACTACACCAGCGATGTCGATGACCTG
ACCGATTTCGCCAACTATTTTCTCTTTTACCTGGGCACCGTCGCGACGGAGGGGAACATCTCTTTGATCTACAAG
TACGCCGAGCGGGTCAAGCAAACGCGAGACGCCTTGAGCCCGGATGGAAGCGACAACCTATACGTCTTGAGCGAT
CTGGCTCAGACGGTCATCCGCAAATACCAGGAGAGGAGGAACTGGAGCTTCCAGGCCTGGCCGGGCAAGGTCGGG
CTGCCGGCCGGGCTCTACGTCGGCCTCCCGTCGAGCGAGGTTGCGCAGCAGATTGCCAAGAAACAGTACATCCCG
GACGAGTTGGACGAGAGGCTGGACGATGTCATGCGGGCTCTGGATCGCAAAAAGAAACGCAAGTCGATGAATGAG
GCAAACGAGCCGCCCGCCAAGCGGACCAAGACGCCGGTCAAGACGGCGGCGATACGAGACCGGTCCGAGCGCAAG
CCCAAAGCGGCGGCGAAGAAGGCGTCGTCCAAGGCAAAGTCGGCGTCGCGCCCCAAGAAGCAGACGCGGCCTTGT
CCGCCCGTGCCGGCGGCGGAACGTCGACGAAGCAGTCGGGCCCACAAGGTGTCGGACTATAAGGAACGAGACGAC
GCCGACGACGAGCAGGAGATGCTGGACGGCGTGGCCGTATGGGACTACGAGGAAGACGACTCGTCCGAGGCGGAG
CGCGAACCAGACGGCAGCGACGAAGCGTCTGACGACGACGACGACGACGACGGCGACGACGGAGACGACGGTGCC
GGGAGTGTGTCCGAGGAGGGAGAAGAGGCGCCGACGAGAAGTAATAGGAAGTCGGCCCCGGTCAAGAATAAGGCC
AAGGCGGCCGGAGGGAACGGACGAATCGGTCGAGCGCAGGGACGGAGGATGGCCAAGGGTTCGTCGGACAGGGAC
GACAACGACGATGATGACGACGACGAA
Transcript >Ophio5|8355
ATGCCGCGTCGTCGCGCGCGTCGCCAGGAGCCCGCCGAAGATGCGGACGACGACGACGAACAACAGGTTCGCAAC
GGATCCGCCGAGCCTCATACGCCCGAGTCACATAAGCAGCCTGAACGAGGCAGCGCAGATGATGAAGACGAGCTG
CCCATCTTGCGCTTCGACGAGGAGCTCTCCTGGCGGCCTGCCAAGCCCATTCCCAGCGCCACCCTCGTCGCTCGG
CTCGAGAAGCTATCCAAGGAACTGGCCGAATTCGATCAGGGCGAGGTCCAGCTTGATTCTCTGCGCTCCGTCGCT
GCTCACCTTGCCCATCGCAACCTGCTGCAGCACAAGGACCGCGGCGTCAAGGCATACACGGCCTGCTGCCTGGTC
GACATTCTGCGCCTCTTCGTCCCGGACGCTCCCTTCACCGACGATCAGCTCAAGATGATGTTTTCACTCTTCGTC
AAGGACATCCTGCCCGCCTTGCACGACTCTACCAACCCGTACAACAGCCAGCACAAATACGTCCTCGTCTCCTTG
ACCGATGTCAAGAGTATCCTTCTCATCTCCGATCTTGACGGAGCCGACGACCTCTTGCTGCGCCTCTTCAACTCG
GCCTTTGACGGCGTCTCGGCTAGCTCAAAGGCCTCGGCCGGCGAGCAGGTCGCCCAGGACGTCGAGATCCTACTG
GCCGAGATGCTCATGGAGCTCATCGACGAGTCGCCTGGCAGTATTCCGGCTACCGTAATCGACGCCATCATCAGT
CAGTTTCTGCGCGCCGCTCCGCCCGGCGGCGGCGGCGGCGGCGGTCGCCACAAGGACGTCAATGGCAAGCAGTCG
ACACTCCTCCGCAAGACGGAACCTCCGGCCTATGTCATGGCCAAGAGCATCTGCAACGGCTGCGCCGACAAGATG
TCGCGCTACGTGAGCCAGTACTTTAGCGACGTCATCCTCAATGCCTCGGGCTTTGCCACCAAGGCAAACAACCAC
CGGCAAGACGACGACTCGGACGAAGAAGACGCCAACGCGGGACCGTCTGATGCCGATCTCAAGAGCCTTCGCCAG
GCCCATCTGCTCATCCGAGAGCTCTGGCGCGCCGCCCCTGACATCCTGCAGAACGTCGTGCCCCAGTTGGACGCT
GAGCTGTCTGCCGACAACGTCCATCTGCGACTGATTGCGACGGAGACGTTTGGCGACATGATCTCGGGCATCGGT
GCCGCCGGTCCTCCTGCTCCGCCGACTCTGGATCCCACTGCCTATCCCCAGCTGCGCCTGATGGACGAGATCCCC
CCGGAACCGGTCGAGATCAACGTTCTGACCAAGCCCTGCTCGCCGCAGTCCTTTGCTCAGACGCACGCCGGGACG
TACCGCAACTTTATCGGCCGCAAGAATGACAAGGCGGGCCCGATTCGGGCGGCTTGGGTCACCGCCGCGGGCTAC
ATCCTATCCACCTCGGCCGGTGGCATCGGCCTCAGCAGAGAGGAAGAGGCCGAACTCGTCAGGGGGCTCGGGGAG
AAGCTCAACGACAGCGAGGAGAAGGTGCGGCTCGCGGCAGTCAATGCCATCGAGCTCTTCGGCTTCCGCGACGTC
GTCTCCAAGCTTGGCGCCACCGGCGGCGTCGACAAGGAGGGCTCCGTCTTTGCCAGCTTGGCGGACAGATGCCGC
GACAGGAAACCAGCCGTGCGCGTCGACGCCATGGTCCTCCTCGGGAAGCTGTGGGCTGTGGGCGCCGGCGAGATT
GCCGACGGACAGGAGGCCGTGACGGCCTGTCTTTCGGGCGTGCCGTCGCGCATCATCAATGCCTTCTACGCCAAC
GACCCCGACCTCAACATTCTCCTCGACAGGGTCATGTTCGAGTGTCTCGTGCCCCTCAAGTACCCGTCCATCAAG
AAGTCGGCCAAGAGCGCGTCCCAGTCCCAGAGCAGCAAGGGCAGCGTCGGACCGGCGGATCAGGACAGGCTACGG
GCCGAGCGAATCCTTCTCATGCTCAAGTTCCTCGACACCGCCGCTCAAAAGGCCTTTTTCGCCATGCAGGCGCGG
CAGCCTCAGTTCGCCCAGGGCGTCGCCATCTTCATCCAGCAGTGCGAGGCGTACAACGGCGGCGTCGTCGACGTC
AACGAGGAAAAGGTCAAGGCGAGCCTGGTCAAGACGTTTCAGTGGCTCGGCGCCTCGTTTCCCGACCCGCTCAAA
GTGCGTGCCGATCTCCAAAAGTTCGCAAAGCTCAACGATCGCCGCGGCTACCAGCTGGTCAAGTACGCGATTGAG
TCGGAGAGCGACTTCAAGACGGTCCGGAGAGCCATCCACGAGCTCATCACCAAGATCCAGGCGAGCTCGGCCTCG
GGCTGTCTGGATACGCTGATTCCCCTCCTCTACCGGTCCAGCTGCCTCATGTTCAACCGCAGCCATCTGGCGACG
ATCATGGACTACTCCAAGAGCGACAAGAACGGCTTCGCCGGCGTCGCCCATCAAGTGCTCAACGACATATCGCAA
CGGAATCCAGACATCTTCAAGGCTCACGTCGGGGAGCTGCACAAGGAGATTACCGAGCAGGCGCCGACGGACAAG
AGGACCAACGATGCGGCCGTGGCGGACATTCTCAAGGCCTACTCGTCCTACTCGAAGCGATACCCGCGCGACATC
AACTGCAACAAGGCCTTCACCCAGACTCTCGTCAACTACGCGCTCTATGGATCGCCCCCCAAGTCTGCCAAATAC
GCAGTCAACATCCTCCTTGCCAGAGACGACGACCGAAGCAAGGTCACGGCCACCAATCTCCTGAGGAGCGCTGTC
AAGGACTTGGATTACGGCACGCCGCACTTTCTCGCCCGGCTGGCCGCCATCAGCCAGCTCGAGCGCCTCGCGCCC
ACCGTCGCTGCCGACTCGGACGAGGATATACACGATTTGACCATCAAGAAGATCCTGCGCGAAGTGCGGACCGAG
GCAAAGGCTGATTCTGACCCTACCTGGGTTCAGGACGTTGACATGGACCAGGAGCTCCAGGCAAAGTGTCTGTCG
CTCCGGATATTGGTCAACCGGGCCATGGCCACGGCCGAGGAGCCGGAGGCCGAGGAACGGGTGAAGCCGGTCTTT
AAGCTGCTCAGGACCTTGGTCGTCGCCGAGGGGGAGTTTTGCAAAACCAAGGACACTCCGTCGCACCACAAGAAG
CGGCTGCGGCTACTGGCGGGCTTGCTGACGCTGAAACTGTGTACGGTGAAGGCGTACGATGAGCAGCTTGAGCCC
ATCAGCTTCAACAAGCTCGCGGAGCTTGTTCAGGACAGCGAGCTCCAGGTCCGTCGGCGCTTCATGGAGAAGCTG
CAGGGCTATCTGACCCGAGGCAGGCTGCGGGCAAGATTCCACACCATCTTGTTCCTGGCCGCCTTTGAGCCCGTG
ACGGAGCTCAAGAACCGGATGGAGACGTGGATCCGGTCTCGGGCTCGTTACTACGAGGAAAAGAAGCAGCAGATT
ATGGAGGCTACCATGGGGAGACTGATTCCTCTGCTGGCGCACCACCCGGACTACACCAGCGATGTCGATGACCTG
ACCGATTTCGCCAACTATTTTCTCTTTTACCTGGGCACCGTCGCGACGGAGGGGAACATCTCTTTGATCTACAAG
TACGCCGAGCGGGTCAAGCAAACGCGAGACGCCTTGAGCCCGGATGGAAGCGACAACCTATACGTCTTGAGCGAT
CTGGCTCAGACGGTCATCCGCAAATACCAGGAGAGGAGGAACTGGAGCTTCCAGGCCTGGCCGGGCAAGGTCGGG
CTGCCGGCCGGGCTCTACGTCGGCCTCCCGTCGAGCGAGGTTGCGCAGCAGATTGCCAAGAAACAGTACATCCCG
GACGAGTTGGACGAGAGGCTGGACGATGTCATGCGGGCTCTGGATCGCAAAAAGAAACGCAAGTCGATGAATGAG
GCAAACGAGCCGCCCGCCAAGCGGACCAAGACGCCGGTCAAGACGGCGGCGATACGAGACCGGTCCGAGCGCAAG
CCCAAAGCGGCGGCGAAGAAGGCGTCGTCCAAGGCAAAGTCGGCGTCGCGCCCCAAGAAGCAGACGCGGCCTTGT
CCGCCCGTGCCGGCGGCGGAACGTCGACGAAGCAGTCGGGCCCACAAGGTGTCGGACTATAAGGAACGAGACGAC
GCCGACGACGAGCAGGAGATGCTGGACGGCGTGGCCGTATGGGACTACGAGGAAGACGACTCGTCCGAGGCGGAG
CGCGAACCAGACGGCAGCGACGAAGCGTCTGACGACGACGACGACGACGACGGCGACGACGGAGACGACGGTGCC
GGGAGTGTGTCCGAGGAGGGAGAAGAGGCGCCGACGAGAAGTAATAGGAAGTCGGCCCCGGTCAAGAATAAGGCC
AAGGCGGCCGGAGGGAACGGACGAATCGGTCGAGCGCAGGGACGGAGGATGGCCAAGGGTTCGTCGGACAGGGAC
GACAACGACGATGATGACGACGACGAATGA
Gene >Ophio5|8355
ATGCCGCGTCGTCGCGCGCGTCGCCAGGAGCCCGCCGAAGATGCGGACGACGACGACGAACAACAGGTTCGCAAC
GGATCCGCCGAGCCTCATACGCCCGAGTCACATAAGCAGCCTGAACGAGGCAGCGCAGATGATGAAGACGAGCTG
CCCATCTTGCGCTTCGACGAGGAGCTCTCCTGGCGGCCTGCCAAGCCCATTCCCAGCGCCACCCTCGTCGCTCGG
CTCGAGAAGCTATCCAAGGAACTGGCCGAATTCGATCAGGGCGAGGTCCAGCTTGATTCTCTGCGCTCCGTCGCT
GCTCACCTTGCCCATCGCAACCTGCTGCAGCACAAGGACCGCGGCGTCAAGGCATACACGGCCTGCTGCCTGGTC
GACATTCTGCGCCTCTTCGTCCCGGACGCTCCCTTCACCGACGATCAGCTCAAGGCGCGTTGCCCTTTTTTTTTT
TTTTTTCTCTCTTTGCGCCGCCCTCCCGCCCACAGCTTGCTGACATGGTCCGCTGCAGATGATGTTTTCACTCTT
CGTCAAGGACATCCTGCCCGCCTTGCACGACTCTACCAACCCGTACAACAGCCAGCACAAATACGTCCTCGTCTC
CTTGACCGATGTCAAGAGTATCCTTCTCATCTCCGATCTTGACGGAGCCGACGACCTCTTGCTGCGCCTCTTCAA
CTCGGCCTTTGACGGCGTCTCGGCTAGCTCAAAGGCCTCGGCCGGCGAGCAGGTCGCCCAGGACGTCGAGATCCT
ACTGGCCGAGATGCTCATGGAGCTCATCGACGAGTCGCCTGGCAGTATTCCGGCTACCGTAATCGACGCCATCAT
CAGTCAGTTTCTGCGCGCCGCTCCGCCCGGCGGCGGCGGCGGCGGCGGTCGCCACAAGGACGTCAATGGCAAGCA
GTCGACACTCCTCCGCAAGACGGAACCTCCGGCCTATGTCATGGCCAAGAGCATCTGCAACGGCTGCGCCGACAA
GATGTCGCGCTACGTGAGCCAGTACTTTAGCGACGTCATCCTCAATGCCTCGGGCTTTGCCACCAAGGCAAACAA
CCACCGGCAAGACGACGACTCGGACGAAGAAGACGCCAACGCGGGACCGTCTGATGCCGATCTCAAGAGCCTTCG
CCAGGCCCATCTGCTCATCCGAGAGCTCTGGCGCGCCGCCCCTGACATCCTGCAGAACGTCGTGCCCCAGTTGGA
CGCTGAGCTGTCTGCCGACAACGTCCATCTGCGACTGATTGCGACGGAGACGTTTGGCGACATGATCTCGGGCAT
CGGTGCCGCCGGTCCTCCTGCTCCGCCGACTCTGGATCCCACTGCCTATCCCCAGCTGCGCCTGATGGACGAGAT
CCCCCCGGAACCGGTCGAGATCAACGTTCTGACCAAGCCCTGCTCGCCGCAGTCCTTTGCTCAGACGCACGCCGG
GACGTACCGCAACTTTATCGGCCGCAAGAATGACAAGGCGGGCCCGATTCGGGCGGCTTGGGTCACCGCCGCGGG
CTACATCCTATCCACCTCGGCCGGTGGCATCGGCCTCAGCAGAGAGGAAGAGGCCGAACTCGTCAGGGGGCTCGG
GGAGAAGCTCAACGACAGCGAGGAGAAGGTGCGGCTCGCGGCAGTCAATGCCATCGAGCTCTTCGGCTTCCGCGA
CGTCGTCTCCAAGCTTGGCGCCACCGGCGGCGTCGACAAGGAGGGCTCCGTCTTTGCCAGCTTGGCGGACAGATG
CCGCGACAGGAAACCAGCCGTGCGCGTCGACGCCATGGTCCTCCTCGGGAAGCTGTGGGCTGTGGGCGCCGGCGA
GATTGCCGACGGACAGGAGGCCGTGACGGCCTGTCTTTCGGGCGTGCCGTCGCGCATCATCAATGCCTTCTACGC
CAACGACCCCGACCTCAACATTCTCCTCGACAGGGTCATGTTCGAGTGTCTCGTGCCCCTCAAGTACCCGTCCAT
CAAGAAGTCGGCCAAGAGCGCGTCCCAGTCCCAGAGCAGCAAGGGCAGCGTCGGACCGGCGGATCAGGACAGGCT
ACGGGCCGAGCGAATCCTTCTCATGCTCAAGTTCCTCGACACCGCCGCTCAAAAGGCCTTTTTCGCCATGCAGGC
GCGGCAGCCTCAGTTCGCCCAGGGCGTCGCCATCTTCATCCAGCAGTGCGAGGCGTACAACGGCGGCGTCGTCGA
CGTCAACGAGGAAAAGGTCAAGGCGAGCCTGGTCAAGACGTTTCAGTGGCTCGGCGCCTCGTTTCCCGACCCGCT
CAAAGTGCGTGCCGATCTCCAAAAGTTCGCAAAGCTCAACGATCGCCGCGGCTACCAGCTGGTCAAGTACGCGAT
TGAGTCGGAGAGCGACTTCAAGACGGTCCGGAGAGCCATCCACGAGCTCATCACCAAGATCCAGGCGAGCTCGGC
CTCGGGCTGTCTGGATACGCTGATTCCCCTCCTCTACCGGTCCAGCTGCCTCATGTTCAACCGCAGCCATCTGGC
GACGATCATGGACTACTCCAAGAGCGACAAGAACGGCTTCGCCGGCGTCGCCCATCAAGTGCTCAACGACATATC
GCAACGGAATCCAGACATCTTCAAGGCTCACGTCGGGGAGCTGCACAAGGAGATTACCGAGCAGGCGCCGACGGA
CAAGAGGACCAACGATGCGGCCGTGGCGGACATTCTCAAGGCCTACTCGTCCTACTCGAAGCGATACCCGCGCGA
CATCAACTGCAACAAGGCCTTCACCCAGACTCTCGTCAACTACGCGCTCTATGGATCGCCCCCCAAGTCTGCCAA
ATACGCAGTCAACATCCTCCTTGCCAGAGACGACGACCGAAGCAAGGTCACGGCCACCAATCTCCTGAGGAGCGC
TGTCAAGGACTTGGATTACGGCACGCCGCACTTTCTCGCCCGGCTGGCCGCCATCAGCCAGCTCGAGCGCCTCGC
GCCCACCGTCGCTGCCGACTCGGACGAGGATATACACGATTTGACCATCAAGAAGATCCTGCGCGAAGTGCGGAC
CGAGGCAAAGGCTGATTCTGACCCTACCTGGGTTCAGGACGTTGACATGGACCAGGAGCTCCAGGCAAAGTGTCT
GTCGCTCCGGATATTGGTCAACCGGGCCATGGCCACGGCCGAGGAGCCGGAGGCCGAGGAACGGGTGAAGCCGGT
CTTTAAGCTGCTCAGGACCTTGGTCGTCGCCGAGGGGGAGTTTTGCAAAACCAAGGACACTCCGTCGCACCACAA
GAAGCGGCTGCGGCTACTGGCGGGCTTGCTGACGCTGAAACTGTGTACGGTGAAGGCGTACGATGAGCAGCTTGA
GCCCATCAGCTTCAACAAGCTCGCGGAGCTTGTTCAGGACAGCGAGCTCCAGGTCCGTCGGCGCTTCATGGAGAA
GCTGCAGGGCTATCTGACCCGAGGCAGGCTGCGGGCAAGATTCCACACCATCTTGTTCCTGGCCGCCTTTGAGCC
CGTGACGGAGCTCAAGAACCGGATGGAGACGTGGATCCGGTCTCGGGCTCGTTACTACGAGGAAAAGAAGCAGCA
GATTATGGAGGCTACCATGGGGAGACTGATTCCTCTGCTGGCGCACCACCCGGACTACACCAGCGATGTCGATGA
CCTGACCGATTTCGCCAACTATTTTCTCTTTTACCTGGGCACCGTCGCGACGGAGGGGAACATCTCTTTGATCTA
CAAGTACGCCGAGCGGGTCAAGCAAACGCGAGACGCCTTGAGCCCGGATGGAAGCGACAACCTATACGTCTTGAG
CGATCTGGCTCAGACGGTCATCCGCAAATACCAGGAGAGGAGGAACTGGAGCTTCCAGGCCTGGCCGGGCAAGGT
CGGGCTGCCGGCCGGGCTCTACGTCGGCCTCCCGTCGAGCGAGGTTGCGCAGCAGATTGCCAAGAAACAGTACAT
CCCGGACGAGTTGGACGAGAGGCTGGACGATGTCATGCGGGCTCTGGATCGCAAAAAGGTAAAAAAAAAAAAAAC
AGAAAGCCTGAACGACGAGAGCCATGCTGATGGCGCAAGCAGAAACGCAAGTCGATGAATGAGGCAAACGAGCCG
CCCGCCAAGCGGACCAAGACGCCGGTCAAGACGGCGGCGATACGAGACCGGTCCGAGCGCAAGCCCAAAGCGGCG
GCGAAGAAGGCGTCGTCCAAGGCAAAGTCGGCGTCGCGCCCCAAGAAGCAGACGCGGCCTTGTCCGCCCGTGCCG
GCGGCGGAACGTCGACGAAGCAGTCGGGCCCACAAGGTGTCGGACTATAAGGAACGAGACGACGCCGACGACGAG
CAGGAGATGCTGGACGGCGTGGCCGTATGGGACTACGAGGAAGACGACTCGTCCGAGGCGGAGCGCGAACCAGAC
GGCAGCGACGAAGCGTCTGACGACGACGACGACGACGACGGCGACGACGGAGACGACGGTGCCGGGAGTGTGTCC
GAGGAGGGAGAAGAGGCGCCGACGAGAAGTAATAGGAAGTCGGCCCCGGTCAAGAATAAGGCCAAGGCGGCCGGA
GGGAACGGACGAATCGGTCGAGCGCAGGGACGGAGGATGGCCAAGGGTTCGTCGGACAGGGACGACAACGACGAT
GATGACGACGACGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail