Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8348
Gene name
Locationscaffold_913:3065..5436
Strand+
Gene length (bp)2371
Transcript length (bp)1977
Coding sequence length (bp)1974
Protein length (aa) 658

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region 9.2E-08 451 602

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7N4|TAD3_SCHPO tRNA-specific adenosine deaminase subunit tad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tad3 PE=3 SV=1 370 658 5.0E-20
sp|Q9URQ3|TAD3_YEAST tRNA-specific adenosine deaminase subunit TAD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAD3 PE=1 SV=1 402 641 8.0E-13
sp|Q96EY9|ADAT3_HUMAN Probable inactive tRNA-specific adenosine deaminase-like protein 3 OS=Homo sapiens GN=ADAT3 PE=1 SV=1 392 601 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8348
MATTPRASVSSAALQISSDAASGKSGGEKQRPVRCHTDSSHLPFRPMATVSPQLDVHLDVHLDVCIRPIASPLLF
LTSSSPALHSRPGPRGKPTSSILLQAGSFSWSRLVWRKTGLSQLPRSLTPFLPPPPQSRKRPFQQSASPPPSPAP
YSPSPDPYLSLFPISNIVTSCPASAPDAVSSFAVPSIRPGADDDAWLGRRPLSPRPLSSGPSTKACFFCDDMAAS
APLDPDRSAPCQMEHDGNKVYSDSVGAEANGKPARPCKILPNPLVDDLKELHVGRGVLIPLKTTQEVRQDHVITQ
AYMTRVPTKSANDVIMAVRTLRPEGSANPLPHLRTCAKPNDLPAHIKTQLMNDTAAGRQIHTSKSTWIYVIVGET
KDFSKEEVLRVLSGLAGVGQDVFVASIPIPLLPPTSQVQAAMWSSQFWPTVYRKNNPLGPHPSVVGRGTDDIKDD
ASVWMALAHQVARDAKRAGIGEAMGAVIVQRSERGAELVGLAGDARRHQASCRGFKNNPMTHCVLRAISMVAQKL
VRHERREGGLSVTRPNLAYDAFQDRPLLDVERACLAQDHPNKDGYLCHGLELYVTHEPCVACSMGILHSRMGKVA
FCKHMPRTGGLSSDDRPDGGGRGLGLFWRRELNWSLLAWEWERDGVAGLPPVDPTTHV
Coding >Ophio5|8348
ATGGCTACGACGCCGCGCGCTTCCGTCTCGTCTGCTGCCCTGCAGATCTCGTCTGACGCGGCTTCGGGAAAATCG
GGCGGGGAAAAACAGCGGCCGGTTCGGTGCCACACCGATTCGTCCCATCTCCCCTTTCGTCCCATGGCTACCGTC
TCTCCACAGCTTGACGTTCACCTTGACGTCCACCTTGACGTCTGCATTCGTCCAATTGCATCACCCTTGCTCTTT
CTGACCTCGTCTTCGCCAGCGCTTCATAGTAGGCCAGGGCCAAGGGGGAAACCGACAAGCTCGATCCTCCTCCAA
GCCGGCTCATTCTCCTGGTCAAGACTGGTTTGGAGAAAGACGGGGCTCTCGCAACTTCCCCGTTCATTGACGCCT
TTTCTCCCCCCCCCCCCCCAAAGCAGGAAGAGACCTTTTCAGCAATCAGCTTCCCCTCCCCCCTCTCCAGCCCCC
TACTCTCCCTCGCCTGATCCCTACCTATCCTTGTTCCCAATTTCAAACATCGTCACGTCGTGTCCAGCCTCGGCT
CCAGACGCCGTTTCCAGCTTCGCCGTCCCTAGCATCAGGCCCGGAGCCGACGACGACGCCTGGCTCGGCCGACGG
CCGCTTTCCCCTCGACCTCTTTCATCTGGCCCGTCGACCAAGGCGTGCTTCTTCTGCGACGACATGGCGGCCTCC
GCGCCGTTGGATCCGGATCGGTCCGCACCCTGCCAAATGGAGCATGATGGCAACAAGGTCTACAGCGACAGCGTC
GGCGCCGAGGCCAACGGCAAGCCCGCGCGGCCATGCAAAATCTTGCCCAATCCTCTGGTCGATGACCTGAAGGAG
TTGCATGTCGGGCGCGGAGTTCTGATTCCTCTCAAGACGACGCAGGAGGTGCGCCAGGACCATGTCATTACTCAG
GCATACATGACGAGGGTGCCGACCAAGTCGGCTAACGACGTGATCATGGCGGTACGCACCTTGCGACCTGAGGGC
AGCGCTAACCCCCTGCCCCATCTCCGGACTTGCGCCAAGCCCAACGACTTGCCGGCACACATCAAGACGCAGTTG
ATGAACGACACGGCGGCCGGGCGGCAGATCCACACGTCCAAGTCGACGTGGATCTACGTCATCGTTGGCGAGACC
AAGGATTTCAGCAAGGAGGAGGTGTTGCGGGTGCTGTCGGGGCTCGCGGGCGTGGGGCAGGACGTGTTTGTGGCG
AGCATCCCGATCCCGCTGCTGCCGCCGACGTCGCAGGTGCAGGCGGCCATGTGGTCTTCACAGTTCTGGCCGACA
GTGTACCGCAAGAACAACCCTCTGGGACCGCACCCGAGCGTGGTGGGGCGCGGAACCGACGACATCAAGGACGAC
GCGTCGGTATGGATGGCGCTGGCACACCAGGTGGCGCGCGATGCCAAGAGGGCGGGCATCGGCGAGGCCATGGGG
GCCGTCATTGTCCAGCGCAGCGAACGGGGCGCCGAGCTTGTCGGTCTGGCCGGGGACGCGCGACGACACCAGGCG
TCGTGTCGAGGCTTCAAGAACAACCCCATGACGCACTGCGTGCTACGGGCCATCAGTATGGTGGCGCAGAAGCTG
GTACGGCACGAGCGGCGGGAGGGCGGGCTGTCGGTGACGAGGCCCAACCTGGCGTACGACGCGTTCCAGGACCGA
CCGCTGCTGGACGTGGAGCGAGCGTGCCTGGCGCAGGACCACCCCAACAAGGACGGCTACCTCTGCCACGGGCTT
GAGCTGTACGTGACGCACGAGCCGTGCGTGGCTTGCTCGATGGGCATCCTGCACTCACGGATGGGCAAGGTGGCG
TTTTGCAAGCACATGCCCCGGACGGGGGGGCTGAGCTCCGACGACCGGCCGGACGGAGGCGGACGAGGGCTGGGC
CTATTTTGGCGACGAGAGCTCAACTGGAGCTTGCTGGCGTGGGAGTGGGAGCGCGATGGAGTTGCCGGCCTGCCG
CCCGTGGACCCGACCACTCATGTT
Transcript >Ophio5|8348
ATGGCTACGACGCCGCGCGCTTCCGTCTCGTCTGCTGCCCTGCAGATCTCGTCTGACGCGGCTTCGGGAAAATCG
GGCGGGGAAAAACAGCGGCCGGTTCGGTGCCACACCGATTCGTCCCATCTCCCCTTTCGTCCCATGGCTACCGTC
TCTCCACAGCTTGACGTTCACCTTGACGTCCACCTTGACGTCTGCATTCGTCCAATTGCATCACCCTTGCTCTTT
CTGACCTCGTCTTCGCCAGCGCTTCATAGTAGGCCAGGGCCAAGGGGGAAACCGACAAGCTCGATCCTCCTCCAA
GCCGGCTCATTCTCCTGGTCAAGACTGGTTTGGAGAAAGACGGGGCTCTCGCAACTTCCCCGTTCATTGACGCCT
TTTCTCCCCCCCCCCCCCCAAAGCAGGAAGAGACCTTTTCAGCAATCAGCTTCCCCTCCCCCCTCTCCAGCCCCC
TACTCTCCCTCGCCTGATCCCTACCTATCCTTGTTCCCAATTTCAAACATCGTCACGTCGTGTCCAGCCTCGGCT
CCAGACGCCGTTTCCAGCTTCGCCGTCCCTAGCATCAGGCCCGGAGCCGACGACGACGCCTGGCTCGGCCGACGG
CCGCTTTCCCCTCGACCTCTTTCATCTGGCCCGTCGACCAAGGCGTGCTTCTTCTGCGACGACATGGCGGCCTCC
GCGCCGTTGGATCCGGATCGGTCCGCACCCTGCCAAATGGAGCATGATGGCAACAAGGTCTACAGCGACAGCGTC
GGCGCCGAGGCCAACGGCAAGCCCGCGCGGCCATGCAAAATCTTGCCCAATCCTCTGGTCGATGACCTGAAGGAG
TTGCATGTCGGGCGCGGAGTTCTGATTCCTCTCAAGACGACGCAGGAGGTGCGCCAGGACCATGTCATTACTCAG
GCATACATGACGAGGGTGCCGACCAAGTCGGCTAACGACGTGATCATGGCGGTACGCACCTTGCGACCTGAGGGC
AGCGCTAACCCCCTGCCCCATCTCCGGACTTGCGCCAAGCCCAACGACTTGCCGGCACACATCAAGACGCAGTTG
ATGAACGACACGGCGGCCGGGCGGCAGATCCACACGTCCAAGTCGACGTGGATCTACGTCATCGTTGGCGAGACC
AAGGATTTCAGCAAGGAGGAGGTGTTGCGGGTGCTGTCGGGGCTCGCGGGCGTGGGGCAGGACGTGTTTGTGGCG
AGCATCCCGATCCCGCTGCTGCCGCCGACGTCGCAGGTGCAGGCGGCCATGTGGTCTTCACAGTTCTGGCCGACA
GTGTACCGCAAGAACAACCCTCTGGGACCGCACCCGAGCGTGGTGGGGCGCGGAACCGACGACATCAAGGACGAC
GCGTCGGTATGGATGGCGCTGGCACACCAGGTGGCGCGCGATGCCAAGAGGGCGGGCATCGGCGAGGCCATGGGG
GCCGTCATTGTCCAGCGCAGCGAACGGGGCGCCGAGCTTGTCGGTCTGGCCGGGGACGCGCGACGACACCAGGCG
TCGTGTCGAGGCTTCAAGAACAACCCCATGACGCACTGCGTGCTACGGGCCATCAGTATGGTGGCGCAGAAGCTG
GTACGGCACGAGCGGCGGGAGGGCGGGCTGTCGGTGACGAGGCCCAACCTGGCGTACGACGCGTTCCAGGACCGA
CCGCTGCTGGACGTGGAGCGAGCGTGCCTGGCGCAGGACCACCCCAACAAGGACGGCTACCTCTGCCACGGGCTT
GAGCTGTACGTGACGCACGAGCCGTGCGTGGCTTGCTCGATGGGCATCCTGCACTCACGGATGGGCAAGGTGGCG
TTTTGCAAGCACATGCCCCGGACGGGGGGGCTGAGCTCCGACGACCGGCCGGACGGAGGCGGACGAGGGCTGGGC
CTATTTTGGCGACGAGAGCTCAACTGGAGCTTGCTGGCGTGGGAGTGGGAGCGCGATGGAGTTGCCGGCCTGCCG
CCCGTGGACCCGACCACTCATGTTTAG
Gene >Ophio5|8348
ATGGCTACGACGCCGCGCGCTTCCGTCTCGTCTGCTGCCCTGCAGATCTCGTCTGACGCGGCTTCGGGAAAATCG
GGCGGGGAAAAACAGCGGCCGGTTCGGTGCCACACCGATTCGTCCCATCTCCCCTTTCGTCCCATGGCGTAAGTC
CCATGTCGCCTTGCCAGCTGTCGGCACTTTCTCGCGGCCCTGCTGAAGCAACCAAACCCCCCCCCCCCCCCTTTC
AGTACCGTCTCTCCACAGCTTGACGTTCACCTTGACGTCCACCTTGACGTCTGCATTCGTCCAATTGCATCACCC
TTGCTCTTTCTGACCTCGTCTTCGCCAGCGCTTCATAGTAGGCCAGTAGGTAGCCCAATTCTTCATGACCTCTTT
TGACGCTCGAGACGGCAACTCATGCAGCCAATTTAGGGGCCAAGGGGGAAGTAAAAAAAAAGGGATTTTTTTTAT
TTTTATTTTAAAAAAAGAGGAAACGCCCAAGTCCCGCGGAGCCAAAAACCACTTACTTTCAACCCACTTCCCAGA
CCGACAAGCTCGATCCTCCTCCAAGCCGGCTCATTCTCCTGGTCAAGACTGGTTTGGTGAGGAGCCCTTTCCCCT
GGCCGAAAGAAAGCTTCCAACTCCCTTTGATTCTTGCTTTCGTTGCTTGACGCGCATTTGCATTAGGAGAAAGAC
GGGGCTCTCGCAACTTCCCCGTTCATTGACGCCTTTTCTCCCCCCCCCCCCCCAAAGCAGGAAGAGACCTTTTCA
GCAATCAGCTTCCCCTCCCCCCTCTCCAGCCCCCTACTCTCCCTCGCCTGATCCCTACCTATCCTTGTTCCCAAT
TTCAAACATCGTCACGTCGTGTCCAGCCTCGGCTCCAGACGCCGTTTCCAGCTTCGCCGTCCCTAGCATCAGGCC
CGGAGCCGACGACGACGCCTGGCTCGGCCGACGGCCGCTTTCCCCTCGACCTCTTTCATCTGGCCCGTCGACCAA
GGCGTGCTTCTTCTGCGACGACATGGCGGCCTCCGCGCCGTTGGATCCGGATCGGTCCGCACCCTGCCAAATGGA
GCATGATGGCAACAAGGTCTACAGCGACAGCGTCGGCGCCGAGGCCAACGGCAAGCCCGCGCGGCCATGCAAAAT
CTTGCCCAATCCTCTGGTCGATGACCTGAAGGAGTTGCATGTCGGGCGCGGAGTTCTGATTCCTCTCAAGACGAC
GCAGGAGGTGCGCCAGGACCATGTCATTACTCAGGCATACATGACGAGGGTGCCGACCAAGTCGGCTAACGACGT
GATCATGTACGTGTCCAGCTCGTGCGGATCAAGAAGCCGCTCCCCGCTGACTGCAGGGCGTGGCAGGGCGGTACG
CACCTTGCGACCTGAGGGCAGCGCTAACCCCCTGCCCCATCTCCGGACTTGCGCCAAGCCCAACGACTTGCCGGC
ACACATCAAGACGCAGTTGATGAACGACACGGCGGCCGGGCGGCAGATCCACACGTCCAAGTCGACGTGGATCTA
CGTCATCGTTGGCGAGACCAAGGATTTCAGCAAGGAGGAGGTGTTGCGGGTGCTGTCGGGGCTCGCGGGCGTGGG
GCAGGACGTGTTTGTGGCGAGCATCCCGATCCCGCTGCTGCCGCCGACGTCGCAGGTGCAGGCGGCCATGTGGTC
TTCACAGTTCTGGCCGACAGTGTACCGCAAGAACAACCCTCTGGGACCGCACCCGAGCGTGGTGGGGCGCGGAAC
CGACGACATCAAGGACGACGCGTCGGTATGGATGGCGCTGGCACACCAGGTGGCGCGCGATGCCAAGAGGGCGGG
CATCGGCGAGGCCATGGGGGCCGTCATTGTCCAGCGCAGCGAACGGGGCGCCGAGCTTGTCGGTCTGGCCGGGGA
CGCGCGACGACACCAGGCGTCGTGTCGAGGCTTCAAGAACAACCCCATGACGCACTGCGTGCTACGGGCCATCAG
TATGGTGGCGCAGAAGCTGGTACGGCACGAGCGGCGGGAGGGCGGGCTGTCGGTGACGAGGCCCAACCTGGCGTA
CGACGCGTTCCAGGACCGACCGCTGCTGGACGTGGAGCGAGCGTGCCTGGCGCAGGACCACCCCAACAAGGACGG
CTACCTCTGCCACGGGCTTGAGCTGTACGTGACGCACGAGCCGTGCGTGGCTTGCTCGATGGGCATCCTGCACTC
ACGGATGGGCAAGGTGGCGTTTTGCAAGCACATGCCCCGGACGGGGGGGCTGAGCTCCGACGACCGGCCGGACGG
AGGCGGACGAGGGCTGGGCCTATTTTGGCGACGAGAGCTCAACTGGAGCTTGCTGGCGTGGGAGTGGGAGCGCGA
TGGAGTTGCCGGCCTGCCGCCCGTGGACCCGACCACTCATGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail