Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8341
Gene name
Locationscaffold_91:41855..44300
Strand+
Gene length (bp)2445
Transcript length (bp)1815
Coding sequence length (bp)1812
Protein length (aa) 604

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.5E-34 168 537

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 138 604 1.0E-63
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 112 604 1.0E-57
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 121 602 2.0E-55
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 108 545 5.0E-47
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 147 597 4.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 138 604 1.0E-63
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 112 604 1.0E-57
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 121 602 2.0E-55
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 108 545 5.0E-47
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 147 597 4.0E-41
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 130 601 1.0E-38
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 119 604 7.0E-35
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 113 595 3.0E-34
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 147 579 5.0E-34
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 143 460 1.0E-33
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 155 458 8.0E-31
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 112 593 2.0E-29
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 138 562 3.0E-29
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 124 603 5.0E-26
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 152 473 1.0E-25
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 109 603 3.0E-25
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 142 460 6.0E-25
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 124 514 3.0E-21
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 132 474 1.0E-20
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 143 539 4.0E-20
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 138 604 5.0E-19
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 140 421 2.0E-17
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 258 373 5.0E-17
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 123 421 7.0E-15
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 150 335 7.0E-15
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 133 569 9.0E-14
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 120 458 1.0E-13
sp|P39398|LGOT_ECOLI Probable L-galactonate transporter OS=Escherichia coli (strain K12) GN=lgoT PE=1 SV=2 158 473 5.0E-11
sp|P0AA76|DGOT_ECOLI D-galactonate transporter OS=Escherichia coli (strain K12) GN=dgoT PE=1 SV=1 161 577 2.0E-09
sp|P0AA77|DGOT_ECOL6 D-galactonate transporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dgoT PE=3 SV=1 161 577 2.0E-09
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 157 399 6.0E-07
sp|Q6NMN6|SPNS1_ARATH Probable sphingolipid transporter spinster homolog 1 OS=Arabidopsis thaliana GN=At5g65687 PE=1 SV=1 154 341 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 163 180 17
2 200 222 22
3 229 251 22
4 255 277 22
5 290 312 22
6 322 344 22
7 397 419 22
8 429 451 22
9 463 485 22
10 489 508 19
11 520 542 22
12 552 571 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 7.96 3.03 12.90
CcL In ants, during behavior modification 24.00 10.52 37.47
CcD In ants, recently dead 12.56 5.48 19.64

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.136667 no
CcL CcD 0.016488 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8341
MDGHPRHTISRVSPAGRKRLGRDKAKRGDGRAISTTPRSFTWNFRGPPLKGRRCTTVATYGCTAFPPLVVLPQSP
LKQFSASLTYNQSIHTYKSTCILCTYLYVVVLKVKPSEVPSLCPSSDGEKQARAQATDRAAGDCESHNDDDLTAE
QQRRIIRRIDRRLIGTVGLLYCVSIIDRTNMSSANIAGMSVELRLQGYRYNLANLVFFITYVVLQPPSTILVRRL
GPRVHLSVVVLLWGAVMTGMGFVSNFSQLVGLRALLGVFESGFFPSTVYLLSTWYTRYEVGKRYSAFYLLSCVAA
SFSGILAFGLMHMGGVAGLGGWRWIFIIEGVATCLLATASYWLLVDFPDSTRSSWRFLSTRERQWIVSRIERDRA
DSTVTTFQPALFLRAARDWRIWIYALIFFNSTTITYALAYTLPLILVGSMGFSVGAAQCLVAPPYVFAGIVMFIS
SWLSDRHKLRGPAIVFNMLLCLMGLPMMGWLGTAAGRYAGVFLLTAGANANVPVTLALQANNVRGQWKRAFCSAT
LVGFGGLGGIAGSLVFRDQDRMTGYRPGLYACVACSLFNIALVALCTWDSRRQNRLADEGRKMLESSEAEPSTEF
RYTY
Coding >Ophio5|8341
ATGGACGGGCATCCACGCCACACAATCAGCCGTGTCTCGCCGGCCGGGCGCAAAAGGCTTGGCAGAGACAAGGCG
AAACGTGGCGACGGGCGGGCAATTTCCACAACGCCACGCAGTTTTACGTGGAATTTTCGGGGCCCCCCCCTCAAA
GGCCGCCGCTGTACGACGGTTGCTACATACGGTTGCACGGCATTTCCGCCCTTGGTAGTATTGCCGCAGTCCCCT
CTGAAGCAATTTTCGGCCTCCCTTACATACAATCAATCCATCCATACATACAAAAGCACATGCATCCTCTGTACA
TATTTGTACGTAGTGGTGCTCAAAGTCAAACCATCGGAAGTTCCTTCCCTCTGTCCGAGCTCGGACGGCGAGAAG
CAGGCTCGAGCCCAGGCGACGGACCGAGCAGCGGGCGATTGCGAGTCGCACAACGATGATGACTTGACGGCGGAG
CAGCAGCGGCGCATCATCCGGCGTATCGACAGGCGGTTGATTGGCACGGTGGGATTGCTCTACTGCGTCAGCATC
ATCGACCGGACGAACATGAGCTCGGCCAACATTGCGGGCATGAGCGTCGAGCTACGGCTCCAGGGATACCGATAC
AACCTGGCCAACCTCGTCTTCTTCATCACCTACGTCGTGCTGCAGCCGCCGTCTACCATTCTGGTCCGTCGACTC
GGGCCACGGGTGCACCTGTCCGTCGTGGTGCTGCTCTGGGGAGCCGTCATGACGGGCATGGGCTTCGTGAGCAAC
TTTTCGCAGCTGGTTGGGTTGAGGGCGCTGCTGGGCGTCTTTGAGTCGGGATTCTTTCCCAGCACCGTCTATCTG
CTCAGCACATGGTATACGCGCTACGAGGTCGGCAAGCGGTATTCCGCCTTTTATCTGCTCAGCTGCGTCGCCGCC
TCCTTTTCCGGCATCCTGGCCTTTGGGCTCATGCACATGGGGGGCGTGGCCGGTCTGGGCGGTTGGCGATGGATC
TTCATCATCGAAGGCGTCGCGACCTGTCTCCTCGCTACTGCAAGCTACTGGCTACTCGTCGACTTTCCCGACTCT
ACACGCTCCTCCTGGCGCTTCCTCTCGACTCGCGAACGGCAATGGATCGTCTCTCGCATCGAGCGTGATCGCGCA
GACTCGACCGTCACGACTTTTCAACCGGCCCTCTTCCTACGGGCAGCACGCGACTGGCGCATCTGGATCTACGCC
CTCATCTTCTTCAACAGCACGACGATAACGTACGCGCTCGCCTACACGCTGCCACTCATCCTGGTCGGCAGCATG
GGCTTCAGCGTCGGGGCGGCCCAGTGTCTCGTGGCCCCGCCGTACGTCTTTGCCGGCATCGTCATGTTCATCAGC
AGCTGGCTCAGCGACCGACACAAGCTACGCGGGCCGGCCATCGTCTTCAACATGTTGCTCTGCCTGATGGGCCTA
CCGATGATGGGCTGGCTGGGCACGGCCGCCGGTCGCTACGCCGGCGTCTTCCTGCTGACGGCCGGGGCCAACGCC
AACGTACCGGTGACGCTGGCGCTACAGGCCAACAACGTGCGCGGTCAGTGGAAGCGAGCCTTCTGCAGCGCCACC
CTCGTCGGCTTCGGTGGTTTGGGTGGCATAGCCGGTAGTCTGGTGTTTCGTGATCAGGATCGGATGACGGGCTAT
CGGCCGGGATTGTATGCCTGCGTTGCCTGTTCGCTGTTCAACATCGCTCTCGTCGCTTTGTGCACCTGGGACTCG
AGGAGGCAGAATCGGCTGGCGGACGAGGGACGCAAGATGCTCGAGTCATCCGAGGCAGAGCCGTCGACCGAGTTT
CGGTACACGTAC
Transcript >Ophio5|8341
ATGGACGGGCATCCACGCCACACAATCAGCCGTGTCTCGCCGGCCGGGCGCAAAAGGCTTGGCAGAGACAAGGCG
AAACGTGGCGACGGGCGGGCAATTTCCACAACGCCACGCAGTTTTACGTGGAATTTTCGGGGCCCCCCCCTCAAA
GGCCGCCGCTGTACGACGGTTGCTACATACGGTTGCACGGCATTTCCGCCCTTGGTAGTATTGCCGCAGTCCCCT
CTGAAGCAATTTTCGGCCTCCCTTACATACAATCAATCCATCCATACATACAAAAGCACATGCATCCTCTGTACA
TATTTGTACGTAGTGGTGCTCAAAGTCAAACCATCGGAAGTTCCTTCCCTCTGTCCGAGCTCGGACGGCGAGAAG
CAGGCTCGAGCCCAGGCGACGGACCGAGCAGCGGGCGATTGCGAGTCGCACAACGATGATGACTTGACGGCGGAG
CAGCAGCGGCGCATCATCCGGCGTATCGACAGGCGGTTGATTGGCACGGTGGGATTGCTCTACTGCGTCAGCATC
ATCGACCGGACGAACATGAGCTCGGCCAACATTGCGGGCATGAGCGTCGAGCTACGGCTCCAGGGATACCGATAC
AACCTGGCCAACCTCGTCTTCTTCATCACCTACGTCGTGCTGCAGCCGCCGTCTACCATTCTGGTCCGTCGACTC
GGGCCACGGGTGCACCTGTCCGTCGTGGTGCTGCTCTGGGGAGCCGTCATGACGGGCATGGGCTTCGTGAGCAAC
TTTTCGCAGCTGGTTGGGTTGAGGGCGCTGCTGGGCGTCTTTGAGTCGGGATTCTTTCCCAGCACCGTCTATCTG
CTCAGCACATGGTATACGCGCTACGAGGTCGGCAAGCGGTATTCCGCCTTTTATCTGCTCAGCTGCGTCGCCGCC
TCCTTTTCCGGCATCCTGGCCTTTGGGCTCATGCACATGGGGGGCGTGGCCGGTCTGGGCGGTTGGCGATGGATC
TTCATCATCGAAGGCGTCGCGACCTGTCTCCTCGCTACTGCAAGCTACTGGCTACTCGTCGACTTTCCCGACTCT
ACACGCTCCTCCTGGCGCTTCCTCTCGACTCGCGAACGGCAATGGATCGTCTCTCGCATCGAGCGTGATCGCGCA
GACTCGACCGTCACGACTTTTCAACCGGCCCTCTTCCTACGGGCAGCACGCGACTGGCGCATCTGGATCTACGCC
CTCATCTTCTTCAACAGCACGACGATAACGTACGCGCTCGCCTACACGCTGCCACTCATCCTGGTCGGCAGCATG
GGCTTCAGCGTCGGGGCGGCCCAGTGTCTCGTGGCCCCGCCGTACGTCTTTGCCGGCATCGTCATGTTCATCAGC
AGCTGGCTCAGCGACCGACACAAGCTACGCGGGCCGGCCATCGTCTTCAACATGTTGCTCTGCCTGATGGGCCTA
CCGATGATGGGCTGGCTGGGCACGGCCGCCGGTCGCTACGCCGGCGTCTTCCTGCTGACGGCCGGGGCCAACGCC
AACGTACCGGTGACGCTGGCGCTACAGGCCAACAACGTGCGCGGTCAGTGGAAGCGAGCCTTCTGCAGCGCCACC
CTCGTCGGCTTCGGTGGTTTGGGTGGCATAGCCGGTAGTCTGGTGTTTCGTGATCAGGATCGGATGACGGGCTAT
CGGCCGGGATTGTATGCCTGCGTTGCCTGTTCGCTGTTCAACATCGCTCTCGTCGCTTTGTGCACCTGGGACTCG
AGGAGGCAGAATCGGCTGGCGGACGAGGGACGCAAGATGCTCGAGTCATCCGAGGCAGAGCCGTCGACCGAGTTT
CGGTACACGTACTGA
Gene >Ophio5|8341
ATGGACGGGTTTTCCTTTGCTTCCTTTTCTTCTTCCCTCTGTTGCATTGGGAGGGGGTTTCCACATTTAGTCGAC
AGCTCTAACGAATAGGCATCCACGCCACACAATCAGCCGTGTCTCGCCGGCCGGGCGCAAAAGTGAGCTTCTGTT
CTGTTCGTCAACGTTTTGCCTGATTGAGCAAGTGTCTCGCCCCGGAAGGCCTAGGGGAAGGGAGGGCCGTTGGGT
CAGCCGGGCTGCTGATTATCGACTGTCTCCCTCCCCACCTTGTCAGACGAGCCATTGGACCCTGACAAGTTGCTC
TTTACAGGGCTTGGCAGAGACAAGGCGAAACGTGGCGACGGGCGGGCAATTTCCACAACGCCACGCAGTTTTACG
TGGAATTTTCGGGGCCCCCCCCTCAAAGGCCGCCGCTGTACGACGGTTGCTACATACGGTTGCACGGCATTTCCG
CCCTTGGTAGTATTGCCGCAGTCCCCTCTGAAGCAATTTTCGGCCTCCCTTACATACAATCAATCCATCCATACA
TACAAAAGCACATGCATCCTCTGTACATATTTGTACGTAGGTAGGTTAGAGGTGTATGAAGCGTTGCCGGTAGGA
GTTGACGGCAGCAGTGGTGCTCAAAGTCAAACCATCGGAAGTTCCTTCCCTCGTCCCTCTCTCGCCGCCTCCCCC
ATCCGCATATCACCATGAACGACAAGTGTCCGAGCTCGGACGGCGAGAAGCAGGCTCGAGCCCAGGCGACGGACC
GAGCAGCGGGCGATTGCGAGTCGCACAACGATGATGACTTGACGGCGGAGCAGCAGCGGCGCATCATCCGGCGTA
TCGACAGGCGGTTGATTGGCACGGTGGGATTGCTCTACTGCGTCAGCATCATCGACCGGACGAACATGAGCTCGG
CCAACATTGCGGGCATGAGCGTCGAGCTACGGCTCCAGGGATACCGATACGTGAGAACCTTTTGTGTTGGTGTGG
TGTGTGTGTGTGTGTCGTGGACGAGGACCGAGCTGATGTTGGGGGTAAAAAAAAAAAAAAAAGAACCTGGCCAAC
CTCGTCTTCTTCATCACCTACGTCGTGCTGCAGCCGCCGTCTACCATTCTGGTCCGTCGACTCGGGCCACGGGTG
CACCTGTCCGTCGTGGTGCTGCTCTGGGGAGCCGTCATGACGGGCATGGGCTTCGTGAGCAACTTTTCGCAGCTG
GTTGGGTTGAGGGCGCTGCTGGGCGTCTTTGAGTCGGGATTCTTTCCCAGCACCGTCTATCTGCTCAGCACATGG
TATACGCGCTGTGAGTTTTATTTATCATTGTTTTTTTTCTCACATGGGAGAGGATGTAGGGAGAGAGAGAGAGAG
ACAGAGAGAGAGAGAAAGAGAGACGGAGACAGAAAATTGATGATGGAATATCGCAGACGAGGTCGGCAAGCGGTA
TTCCGCCTTTTATCTGCTCAGCTGCGTCGCCGCCTCCTTTTCCGGCATCCTGGCCTTTGGGGTGCGTTCGACGGC
CGCCTCTCCGACTGTTTGTGTCTCGGCTGACGATATGGGGGGGTGCGGGGGACGCAGCTCATGCACATGGGGGGC
GTGGCCGGTCTGGGCGGTTGGCGATGGATCTTCATCATCGAAGGCGTCGCGACCTGTCTCCTCGCTACTGCAAGC
TACTGGCTACTCGTCGACTTTCCCGACTCTACACGCTCCTCCTGGCGCTTCCTCTCGACTCGCGAACGGCAATGG
ATCGTCTCTCGCATCGAGCGTGATCGCGCAGACTCGACCGTCACGACTTTTCAACCGGCCCTCTTCCTACGGGCA
GCACGCGACTGGCGCATCTGGATCTACGCCCTCATCTTCTTCAACAGCACGACGATAACGTACGCGCTCGCCTAC
ACGCTGCCACTCATCCTGGTCGGCAGCATGGGCTTCAGCGTCGGGGCGGCCCAGTGTCTCGTGGCCCCGCCGTAC
GTCTTTGCCGGCATCGTCATGTTCATCAGCAGCTGGCTCAGCGACCGACACAAGCTACGCGGGCCGGCCATCGTC
TTCAACATGTTGCTCTGCCTGATGGGCCTACCGATGATGGGCTGGCTGGGCACGGCCGCCGGTCGCTACGCCGGC
GTCTTCCTGCTGACGGCCGGGGCCAACGCCAACGTACCGGTGACGCTGGCGCTACAGGCCAACAACGTGCGCGGT
CAGTGGAAGCGAGCCTTCTGCAGCGCCACCCTCGTCGGCTTCGGTGGTTTGGGTGGCATAGCCGGTAGTCTGGTG
TTTCGTGATCAGGATCGGATGACGGGCTATCGGCCGGGATTGTATGCCTGCGTTGCCTGTTCGCTGTTCAACATC
GCTCTCGTCGCTTTGTGCACCTGGGACTCGAGGAGGCAGAATCGGCTGGCGGACGAGGGACGCAAGATGCTCGAG
TCATCCGAGGCAGAGCCGTCGACCGAGTTTCGGTACACGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail