Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8340
Gene name
Locationscaffold_91:39593..41732
Strand+
Gene length (bp)2139
Transcript length (bp)1800
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01553 Acyltransferase Acyltransferase 3.7E-27 323 478
PF16076 Acyltransf_C Acyltransferase C-terminus 8.5E-12 497 566

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94361|YHOE_SCHPO Uncharacterized acyltransferase C428.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.14 PE=3 SV=1 239 587 8.0E-63
sp|P38226|CST26_YEAST Uncharacterized acyltransferase CST26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CST26 PE=1 SV=1 277 593 3.0E-61
sp|Q12185|YD018_YEAST Uncharacterized acyltransferase YDR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR018C PE=3 SV=1 232 552 2.0E-48
sp|Q8L4Y2|LPAT4_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 4 OS=Arabidopsis thaliana GN=LPAT4 PE=2 SV=1 277 551 6.0E-32
sp|Q9LHN4|LPAT5_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5 OS=Arabidopsis thaliana GN=LPAT5 PE=2 SV=1 323 551 2.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94361|YHOE_SCHPO Uncharacterized acyltransferase C428.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.14 PE=3 SV=1 239 587 8.0E-63
sp|P38226|CST26_YEAST Uncharacterized acyltransferase CST26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CST26 PE=1 SV=1 277 593 3.0E-61
sp|Q12185|YD018_YEAST Uncharacterized acyltransferase YDR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR018C PE=3 SV=1 232 552 2.0E-48
sp|Q8L4Y2|LPAT4_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 4 OS=Arabidopsis thaliana GN=LPAT4 PE=2 SV=1 277 551 6.0E-32
sp|Q9LHN4|LPAT5_ARATH Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5 OS=Arabidopsis thaliana GN=LPAT5 PE=2 SV=1 323 551 2.0E-29
sp|Q6NYV8|LCLT1_DANRE Lysocardiolipin acyltransferase 1 OS=Danio rerio GN=lclat1 PE=1 SV=1 323 557 2.0E-26
sp|Q5F3X0|LCLT1_CHICK Lysocardiolipin acyltransferase 1 OS=Gallus gallus GN=LCLAT1 PE=2 SV=1 240 549 1.0E-25
sp|Q6UWP7|LCLT1_HUMAN Lysocardiolipin acyltransferase 1 OS=Homo sapiens GN=LCLAT1 PE=1 SV=1 227 592 2.0E-24
sp|Q3UN02|LCLT1_MOUSE Lysocardiolipin acyltransferase 1 OS=Mus musculus GN=Lclat1 PE=1 SV=2 250 544 4.0E-24
sp|Q6IWY1|LPAT2_BRAOL 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica oleracea GN=LPAT2 PE=2 SV=1 323 597 2.0E-23
sp|Q9XFW4|LPAT2_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica napus GN=LPAT2 PE=2 SV=1 323 551 6.0E-23
sp|Q8LG50|LPAT2_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana GN=LPAT2 PE=1 SV=2 323 586 2.0E-22
sp|Q5RA57|PLCC_PONAB 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Pongo abelii GN=AGPAT3 PE=2 SV=1 323 585 3.0E-22
sp|Q9NRZ7|PLCC_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Homo sapiens GN=AGPAT3 PE=1 SV=1 323 585 4.0E-22
sp|Q5R757|PLCD_PONAB 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Pongo abelii GN=AGPAT4 PE=2 SV=1 323 551 1.0E-21
sp|Q41745|LPAT_MAIZE 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 OS=Zea mays GN=PLS1 PE=2 SV=1 323 567 1.0E-21
sp|Q9NRZ5|PLCD_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Homo sapiens GN=AGPAT4 PE=1 SV=1 323 551 1.0E-21
sp|Q9SYC8|LPAT3_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana GN=LPAT3 PE=2 SV=1 323 566 2.0E-21
sp|Q924S1|PLCD_RAT 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Rattus norvegicus GN=Agpat4 PE=2 SV=1 323 551 2.0E-20
sp|Q8K4X7|PLCD_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Mus musculus GN=Agpat4 PE=1 SV=1 323 551 2.0E-20
sp|Q4R581|PLCD_MACFA 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Macaca fascicularis GN=AGPAT4 PE=2 SV=1 323 551 7.0E-20
sp|Q5E9R2|PLCD_BOVIN 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Bos taurus GN=AGPAT4 PE=2 SV=1 323 551 2.0E-19
sp|Q9D517|PLCC_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Mus musculus GN=Agpat3 PE=1 SV=2 323 585 2.0E-19
sp|Q9NUQ2|PLCE_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Homo sapiens GN=AGPAT5 PE=1 SV=3 323 551 4.0E-18
sp|Q9D1E8|PLCE_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Mus musculus GN=Agpat5 PE=2 SV=2 323 551 2.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 238 260 22
2 270 292 22
3 365 382 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8340
MSRLTRKRFVAALQRGPRGHLLGVSGARCPDRKPISDNASGAGGYSVRARSWYLGQRTKDARGLVPNEPRPTVAA
ARLKHPRQSRPAAIGPSTTALVGVGVRRTLTYHHKGSPGPSFAPLGSPFTWIPACSYYSCSRLASLFVSSSASRL
ASFAVSSSACIHRDCYPLSSASLFLALFASPPHRSSPRSKMDRQFSRPSEPDGVHPGARPPAASKRPPAIAHPSG
KEAYGRLVQVLRGIALAAYFGLCSGSILVSQAIGVPLYFIDRDWFYAYVAFTKRAFALTAALMTHIWGPTTMRIS
GDESIAGQIKPMPDGGVQFSFPERLVLIANHQIYTDWLYLWWIAYANRPGMAGHIYIILKESLKYVPFIGPAMMF
YGFIFMSRKMATDQPRLAYRINKLNKTKTGPDGRPYLDPMWLLLFPEGTNLSTNGRQKSAKWANQKGLRDPEHVL
LPRSTGILFCLNQLKGTVDYVYDCTVAYEGVPRGKYGEQLFGLASTYFQGRSPKSVNLYWRRYRLADLPLHDAAE
FDEWLRDEWYKKDELMEAYLRTGRFPALTDGPVKYVEAPVRTRRPFEILQIFTPPATVLLLCWRLFKLLRGLLT
Coding >Ophio5|8340
ATGAGTCGATTAACCAGAAAGAGATTCGTAGCGGCTTTGCAGCGTGGCCCACGAGGCCACCTCCTCGGTGTATCA
GGTGCCCGATGCCCGGACCGCAAGCCAATCAGCGACAACGCATCAGGTGCCGGTGGGTACAGTGTCCGTGCGCGT
TCTTGGTACCTAGGGCAAAGGACCAAGGACGCACGCGGACTCGTTCCGAACGAACCACGACCGACTGTTGCAGCA
GCGCGCTTAAAACACCCGCGGCAGTCGCGCCCCGCTGCAATCGGACCCTCGACAACAGCCCTCGTGGGCGTGGGC
GTCAGACGAACTCTAACTTATCACCACAAGGGGAGTCCAGGGCCGTCGTTTGCGCCCCTTGGATCTCCCTTTACT
TGGATCCCTGCCTGTTCTTATTATTCTTGCTCCCGATTGGCCTCTTTGTTTGTCTCTTCGTCCGCCTCCCGTCTA
GCCTCGTTTGCTGTGTCGAGTTCCGCTTGCATCCATCGCGACTGCTATCCGCTGTCGTCCGCTTCTCTGTTCCTG
GCTCTCTTTGCCTCGCCTCCACACCGGTCTTCACCGCGCTCGAAAATGGATCGACAGTTTTCCCGTCCCTCCGAG
CCCGACGGCGTGCATCCCGGAGCCCGACCGCCGGCCGCCTCGAAAAGGCCCCCGGCCATCGCCCATCCATCGGGA
AAAGAGGCCTATGGACGTCTCGTTCAGGTCCTTCGCGGAATCGCGCTCGCCGCATACTTTGGTCTTTGCTCCGGC
TCCATCCTTGTCTCACAGGCCATCGGCGTGCCGCTCTACTTCATCGACCGCGACTGGTTCTACGCATACGTCGCC
TTTACCAAGCGCGCCTTCGCCCTTACCGCGGCGCTCATGACGCATATCTGGGGGCCCACGACGATGCGCATCAGT
GGCGATGAATCCATCGCCGGCCAGATCAAGCCCATGCCCGACGGTGGCGTCCAATTCTCCTTTCCCGAGCGCCTC
GTCCTCATCGCCAACCACCAGATCTACACCGATTGGTTGTACCTCTGGTGGATCGCCTACGCCAATCGCCCCGGC
ATGGCCGGTCACATCTACATCATCCTCAAAGAGTCGCTCAAGTACGTCCCCTTCATCGGGCCTGCCATGATGTTC
TACGGCTTCATCTTCATGTCGAGGAAGATGGCGACGGATCAGCCACGGCTGGCCTACCGCATCAATAAGCTCAAC
AAGACCAAGACGGGCCCCGACGGCCGCCCCTATCTCGACCCCATGTGGCTGCTGCTCTTCCCCGAAGGAACCAAC
TTGTCAACCAACGGCCGCCAGAAGTCGGCCAAATGGGCCAATCAGAAGGGTCTCAGGGATCCCGAGCACGTCCTG
CTGCCGCGCAGCACCGGCATCTTGTTCTGCCTCAACCAGCTCAAGGGCACCGTCGATTACGTCTACGACTGCACC
GTCGCTTACGAGGGAGTCCCCCGGGGCAAATACGGCGAGCAGCTCTTCGGCCTGGCCAGCACCTATTTCCAGGGC
CGGTCACCCAAGTCGGTCAACCTATACTGGCGGCGTTACCGCCTCGCCGACCTACCGCTGCACGACGCGGCCGAG
TTCGACGAGTGGCTGCGTGACGAGTGGTACAAAAAGGACGAGCTGATGGAGGCCTATTTGAGAACGGGCCGCTTC
CCGGCCTTGACCGACGGGCCGGTCAAATACGTCGAGGCTCCCGTCCGGACGCGGCGGCCGTTTGAGATTTTGCAG
ATCTTTACCCCGCCCGCCACCGTCTTGCTGCTCTGCTGGCGCCTCTTCAAGCTGCTGCGCGGTTTGTTGACG
Transcript >Ophio5|8340
ATGAGTCGATTAACCAGAAAGAGATTCGTAGCGGCTTTGCAGCGTGGCCCACGAGGCCACCTCCTCGGTGTATCA
GGTGCCCGATGCCCGGACCGCAAGCCAATCAGCGACAACGCATCAGGTGCCGGTGGGTACAGTGTCCGTGCGCGT
TCTTGGTACCTAGGGCAAAGGACCAAGGACGCACGCGGACTCGTTCCGAACGAACCACGACCGACTGTTGCAGCA
GCGCGCTTAAAACACCCGCGGCAGTCGCGCCCCGCTGCAATCGGACCCTCGACAACAGCCCTCGTGGGCGTGGGC
GTCAGACGAACTCTAACTTATCACCACAAGGGGAGTCCAGGGCCGTCGTTTGCGCCCCTTGGATCTCCCTTTACT
TGGATCCCTGCCTGTTCTTATTATTCTTGCTCCCGATTGGCCTCTTTGTTTGTCTCTTCGTCCGCCTCCCGTCTA
GCCTCGTTTGCTGTGTCGAGTTCCGCTTGCATCCATCGCGACTGCTATCCGCTGTCGTCCGCTTCTCTGTTCCTG
GCTCTCTTTGCCTCGCCTCCACACCGGTCTTCACCGCGCTCGAAAATGGATCGACAGTTTTCCCGTCCCTCCGAG
CCCGACGGCGTGCATCCCGGAGCCCGACCGCCGGCCGCCTCGAAAAGGCCCCCGGCCATCGCCCATCCATCGGGA
AAAGAGGCCTATGGACGTCTCGTTCAGGTCCTTCGCGGAATCGCGCTCGCCGCATACTTTGGTCTTTGCTCCGGC
TCCATCCTTGTCTCACAGGCCATCGGCGTGCCGCTCTACTTCATCGACCGCGACTGGTTCTACGCATACGTCGCC
TTTACCAAGCGCGCCTTCGCCCTTACCGCGGCGCTCATGACGCATATCTGGGGGCCCACGACGATGCGCATCAGT
GGCGATGAATCCATCGCCGGCCAGATCAAGCCCATGCCCGACGGTGGCGTCCAATTCTCCTTTCCCGAGCGCCTC
GTCCTCATCGCCAACCACCAGATCTACACCGATTGGTTGTACCTCTGGTGGATCGCCTACGCCAATCGCCCCGGC
ATGGCCGGTCACATCTACATCATCCTCAAAGAGTCGCTCAAGTACGTCCCCTTCATCGGGCCTGCCATGATGTTC
TACGGCTTCATCTTCATGTCGAGGAAGATGGCGACGGATCAGCCACGGCTGGCCTACCGCATCAATAAGCTCAAC
AAGACCAAGACGGGCCCCGACGGCCGCCCCTATCTCGACCCCATGTGGCTGCTGCTCTTCCCCGAAGGAACCAAC
TTGTCAACCAACGGCCGCCAGAAGTCGGCCAAATGGGCCAATCAGAAGGGTCTCAGGGATCCCGAGCACGTCCTG
CTGCCGCGCAGCACCGGCATCTTGTTCTGCCTCAACCAGCTCAAGGGCACCGTCGATTACGTCTACGACTGCACC
GTCGCTTACGAGGGAGTCCCCCGGGGCAAATACGGCGAGCAGCTCTTCGGCCTGGCCAGCACCTATTTCCAGGGC
CGGTCACCCAAGTCGGTCAACCTATACTGGCGGCGTTACCGCCTCGCCGACCTACCGCTGCACGACGCGGCCGAG
TTCGACGAGTGGCTGCGTGACGAGTGGTACAAAAAGGACGAGCTGATGGAGGCCTATTTGAGAACGGGCCGCTTC
CCGGCCTTGACCGACGGGCCGGTCAAATACGTCGAGGCTCCCGTCCGGACGCGGCGGCCGTTTGAGATTTTGCAG
ATCTTTACCCCGCCCGCCACCGTCTTGCTGCTCTGCTGGCGCCTCTTCAAGCTGCTGCGCGGTTTGTTGACGTAG
Gene >Ophio5|8340
ATGAGTCGATTAACCAGAAAGAGATTCGTAGCGGCTTTGCAGCGTGGCCCACGAGGCCACCTCCTCGGTGTATCA
GGTGCCCGATGCCCGGACCGCAAGCCAATCAGCGACAACGCATCAGGTGCCGGTGGGTACAGTGTCCGTGCGCGT
TCTTGGTACCTAGGTAGGGAAGGAAGGCAGATACGAATACGAAGACGATTCCAAGGGCAAAGGACCAAGGACGCA
CGCGGACTCGTCAGCCGGACATGACGATTATAATACTGAGAATTCGTTCCCCATGTAAAATGATAGGTTCCGAGT
AAGTCTTCCTCAAACATGTCCAGTCGCAGCGGCTCAAACTAACGCGGACAGACGAACCACGACCGACTGTTGCAG
CAGCGCGCTTAAAACACCCGCGGCAGTCGCGCCCCGCTGCAATCGGACCCTCGACAACAGCCCTCGTGGGCGTGG
GCGTCAGACGAACTCTAACTTATCACCACAAGGGGAGTCCAGGGCCGTCGTTTGCGCCCCTTGGATCTCCCTTTA
CTTGGATCCCTGCCTGTTCTTATTATTCTTGCTCCCGATTGGCCTCTTTGTTTGTCTCTTCGTCCGCCTCCCGTC
TAGCCTCGTTTGCTGTGTCGAGTTCCGCTTGCATCCATCGCGACTGCTATCCGCTGTCGTCCGCTTCTCTGTTCC
TGGCTCTCTTTGCCTCGCCTCCACACCGGTCTTCACCGCGCTCGAAAATGGATCGACAGTTTTCCCGTCCCTCCG
AGCCCGACGGCGTGCATCCCGGAGCCCGACCGCCGGCCGCCTCGAAAAGGCCCCCGGCCATCGCCCATCCATCGG
GAAAAGAGGCCTATGGACGTCTCGTTCAGGTCCTTCGCGGAATCGCGCTCGCCGCATACTTTGGTCTTTGCTCCG
GCTCGTACGTCTCGTCTCTGTCTTGCCTCTTCTCCCTCTTCTAGGGCCCTACCTCGCCGCTGACGTCTGTCGCTC
GCTCAGCATCCTTGTCTCACAGGCCATCGGCGTGCCGCTCTACTTCATCGACCGCGACTGGTTCTACGCATACGT
CGCCTTTACCAAGCGCGCCTTCGCCCTTACCGCGGCGCTCATGACGCATATCTGGGGGCCCACGACGATGCGCAT
CAGTGGCGATGAATCCATCGCCGGCCAGATCAAGCCCATGCCCGACGGTGGCGTCCAATTCTCCTTTCCCGAGCG
CCTCGTCCTCATCGCCAACCACCAGGTGACGAAAGGCCCCTTTCGAGATGCTACGACGACGTCGACTGACAACGA
GCAGATCTACACCGATTGGTTGTACCTCTGGTGGATCGCCTACGCCAATCGCCCCGGCATGGCCGGTCACATCTA
CATCATCCTCAAAGAGTCGCTCAAGTACGTCCCCTTCATCGGGCCTGCCATGATGTTCTACGGCTTCATCTTCAT
GTCGAGGAAGATGGCGACGGATCAGCCACGGCTGGCCTACCGCATCAATAAGCTCAACAAGACCAAGACGGGCCC
CGACGGCCGCCCCTATCTCGACCCCATGTGGCTGCTGCTCTTCCCCGAAGGAACCAACTTGTCAACCAACGGCCG
CCAGAAGTCGGCCAAATGGGCCAATCAGAAGGGTCTCAGGGATCCCGAGCACGTCCTGCTGCCGCGCAGCACCGG
CATCTTGTTCTGCCTCAACCAGCTCAAGGGCACCGTCGATTACGTCTACGACTGCACCGTCGCTTACGAGGGAGT
CCCGTGAGTGGCCCCAACCCCTTTCTATATCTGTCGCCGACCGCTGACGACGGCCGCAGCCGGGGCAAATACGGC
GAGCAGCTCTTCGGCCTGGCCAGCACCTATTTCCAGGGCCGGTCACCCAAGTCGGTCAACCTATACTGGCGGCGT
TACCGCCTCGCCGACCTACCGCTGCACGACGCGGCCGAGTTCGACGAGTGGCTGCGTGACGAGTGGTACAAAAAG
GACGAGCTGATGGAGGCCTATTTGAGAACGGGCCGCTTCCCGGCCTTGACCGACGGGCCGGTCAAATACGTCGAG
GCTCCCGTCCGGACGCGGCGGCCGTTTGAGATTTTGCAGATCTTTACCCCGCCCGCCACCGTCTTGCTGCTCTGC
TGGCGCCTCTTCAAGCTGCTGCGCGGTTTGTTGACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail