Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8334
Gene name
Locationscaffold_91:24835..27922
Strand+
Gene length (bp)3087
Transcript length (bp)3033
Coding sequence length (bp)3030
Protein length (aa) 1010

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 1.3E-37 175 350

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1D432|PFF1_NEOFI Vacuolar membrane protease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_018760 PE=3 SV=1 5 1005 0.0E+00
sp|E9CZZ9|PFF1_COCPS Vacuolar membrane protease OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_03427 PE=3 SV=1 5 1005 0.0E+00
sp|C8V4D5|PFF1_EMENI Vacuolar membrane protease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10522 PE=3 SV=1 5 1006 0.0E+00
sp|A1CR68|PFF1_ASPCL Vacuolar membrane protease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_028640 PE=3 SV=1 5 1005 0.0E+00
sp|D4AMV1|PFF1_ARTBC Vacuolar membrane protease OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05554 PE=3 SV=1 5 1008 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1D432|PFF1_NEOFI Vacuolar membrane protease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_018760 PE=3 SV=1 5 1005 0.0E+00
sp|E9CZZ9|PFF1_COCPS Vacuolar membrane protease OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_03427 PE=3 SV=1 5 1005 0.0E+00
sp|C8V4D5|PFF1_EMENI Vacuolar membrane protease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10522 PE=3 SV=1 5 1006 0.0E+00
sp|A1CR68|PFF1_ASPCL Vacuolar membrane protease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_028640 PE=3 SV=1 5 1005 0.0E+00
sp|D4AMV1|PFF1_ARTBC Vacuolar membrane protease OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05554 PE=3 SV=1 5 1008 0.0E+00
sp|D4D8C1|PFF1_TRIVH Vacuolar membrane protease OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03357 PE=3 SV=1 5 1001 0.0E+00
sp|E5QYX6|PFF1_ARTGP Vacuolar membrane protease OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_01137 PE=3 SV=1 5 1001 0.0E+00
sp|Q4WJH4|PFF1_ASPFU Vacuolar membrane protease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G05960 PE=3 SV=1 5 1005 0.0E+00
sp|B0XPG0|PFF1_ASPFC Vacuolar membrane protease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_006350 PE=3 SV=1 5 1005 0.0E+00
sp|B2W0S3|PFF1_PYRTR Vacuolar membrane protease OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_04058 PE=3 SV=1 1 1001 0.0E+00
sp|E3RFJ1|PFF1_PYRTT Vacuolar membrane protease OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_06479 PE=3 SV=1 1 1001 0.0E+00
sp|E9E6S9|PFF1_METAQ Vacuolar membrane protease OS=Metarhizium acridum (strain CQMa 102) GN=MAC_05577 PE=3 SV=1 1 1008 0.0E+00
sp|C6H1N5|PFF1_AJECH Vacuolar membrane protease OS=Ajellomyces capsulatus (strain H143) GN=HCDG_00617 PE=3 SV=1 5 901 0.0E+00
sp|C5FDH0|PFF1_ARTOC Vacuolar membrane protease OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_00832 PE=3 SV=1 5 1008 0.0E+00
sp|B8NSP6|PFF1_ASPFN Vacuolar membrane protease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_049970 PE=3 SV=1 5 839 0.0E+00
sp|Q0URQ5|PFF1_PHANO Vacuolar membrane protease OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_05559 PE=3 SV=1 5 1001 0.0E+00
sp|A2RAN5|PFF1_ASPNC Vacuolar membrane protease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An18g03780 PE=3 SV=1 1 1001 0.0E+00
sp|D5GI81|PFF1_TUBMM Vacuolar membrane protease OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00008325001 PE=3 SV=1 2 1001 0.0E+00
sp|Q1K7M0|PFF1_NEUCR Vacuolar membrane protease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=9G6.250 PE=3 SV=1 5 625 0.0E+00
sp|C7Z274|PFF1_NECH7 Vacuolar membrane protease OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_96958 PE=3 SV=1 1 1008 0.0E+00
sp|D1ZV85|PFF1_SORMK Vacuolar membrane protease OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_04453 PE=3 SV=1 5 585 0.0E+00
sp|C5P998|PFF1_COCP7 Vacuolar membrane protease OS=Coccidioides posadasii (strain C735) GN=CPC735_004820 PE=3 SV=1 5 1005 0.0E+00
sp|E9EYB5|PFF1_METRA Vacuolar membrane protease OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=MAA_05014 PE=3 SV=1 1 1008 0.0E+00
sp|C9SXB4|PFF1_VERA1 Vacuolar membrane protease OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_09414 PE=3 SV=1 1 1001 0.0E+00
sp|E3Q4R4|PFF1_COLGM Vacuolar membrane protease OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_01223 PE=3 SV=1 1 1009 0.0E+00
sp|B2B585|PFF1_PODAN Vacuolar membrane protease OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_3840 PE=3 SV=1 5 1005 0.0E+00
sp|A6S8A1|PFF1_BOTFB Vacuolar membrane protease OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_08418 PE=3 SV=1 1 1005 0.0E+00
sp|A7F4S1|PFF1_SCLS1 Vacuolar membrane protease OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_12596 PE=3 SV=1 1 1005 0.0E+00
sp|A4R254|PFF1_MAGO7 Vacuolar membrane protease OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_06752 PE=3 SV=2 3 1008 0.0E+00
sp|Q2GXG8|PFF1_CHAGB Vacuolar membrane protease OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07336 PE=3 SV=1 5 1005 0.0E+00
sp|C1GTI3|PFF1_PARBA Vacuolar membrane protease OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_01828 PE=3 SV=1 5 1001 0.0E+00
sp|B6H1I3|PFF1_PENRW Vacuolar membrane protease OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc13g02170 PE=3 SV=1 2 1006 0.0E+00
sp|C1G0X0|PFF1_PARBD Vacuolar membrane protease OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00510 PE=3 SV=1 5 1001 0.0E+00
sp|C0S345|PFF1_PARBP Vacuolar membrane protease OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02109 PE=3 SV=1 5 1001 0.0E+00
sp|C5JPM9|PFF1_AJEDS Vacuolar membrane protease OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_05051 PE=3 SV=1 5 1007 0.0E+00
sp|C5G8H4|PFF1_AJEDR Vacuolar membrane protease OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_00606 PE=3 SV=1 5 1007 0.0E+00
sp|B6Q656|PFF1_TALMQ Vacuolar membrane protease OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_024220 PE=3 SV=1 5 1006 0.0E+00
sp|Q2UU23|PFF1_ASPOR Vacuolar membrane protease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090009000488 PE=3 SV=1 5 1006 0.0E+00
sp|B8M853|PFF1_TALSN Vacuolar membrane protease OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_032680 PE=3 SV=1 5 1006 0.0E+00
sp|C0NU79|PFF1_AJECG Vacuolar membrane protease OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_06910 PE=3 SV=1 5 1006 0.0E+00
sp|E4ZQC4|PFF1_LEPMJ Vacuolar membrane protease OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P032730 PE=3 SV=1 1 840 1.0E-172
sp|D8QAM0|PFF1_SCHCM Vacuolar membrane protease OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_69280 PE=3 SV=1 13 1001 4.0E-109
sp|A6QS12|PFF1_AJECN Vacuolar membrane protease OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_00168 PE=3 SV=1 321 1006 5.0E-106
sp|C7GQI9|PFF1_YEAS2 Vacuolar membrane protease OS=Saccharomyces cerevisiae (strain JAY291) GN=C1Q_02588 PE=3 SV=1 1 1007 4.0E-84
sp|A6ZL18|PFF1_YEAS7 Vacuolar membrane protease OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_0288 PE=3 SV=1 1 1007 5.0E-84
sp|D3UEH0|PFF1_YEAS8 Vacuolar membrane protease OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1B15_2135g PE=3 SV=1 1 1007 8.0E-84
sp|B5VE39|PFF1_YEAS6 Vacuolar membrane protease OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AWRI1631_21620 PE=3 SV=1 1 1007 1.0E-83
sp|B3LN75|PFF1_YEAS1 Vacuolar membrane protease OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_02892 PE=3 SV=1 1 1007 1.0E-83
sp|P38244|PFF1_YEAST Vacuolar membrane protease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFF1 PE=1 SV=3 1 1007 7.0E-83
sp|Q1K7M0|PFF1_NEUCR Vacuolar membrane protease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=9G6.250 PE=3 SV=1 618 1010 6.0E-82
sp|D1ZV85|PFF1_SORMK Vacuolar membrane protease OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_04453 PE=3 SV=1 617 1010 7.0E-77
sp|Q6FK15|PFF1_CANGA Vacuolar membrane protease OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0M01936g PE=3 SV=1 38 1008 2.0E-73
sp|Q750Z6|PFF1_ASHGO Vacuolar membrane protease OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGL209W PE=3 SV=1 18 1008 3.0E-73
sp|A5DZ28|PFF1_LODEL Vacuolar membrane protease OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_02615 PE=3 SV=1 7 1009 6.0E-73
sp|C5E0G6|PFF1_ZYGRC Vacuolar membrane protease OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0G12540g PE=3 SV=1 14 1008 1.0E-72
sp|Q6CKC6|PFF1_KLULA Vacuolar membrane protease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F11748g PE=3 SV=1 42 1005 2.0E-71
sp|B6K327|PFF1_SCHJY Vacuolar membrane protease OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_03009 PE=3 SV=1 48 1006 4.0E-71
sp|C5DDZ2|PFF1_LACTC Vacuolar membrane protease OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KLTH0C04972g PE=3 SV=1 40 1003 6.0E-70
sp|Q6BMD6|PFF1_DEBHA Vacuolar membrane protease OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2F06380g PE=3 SV=2 7 1008 2.0E-66
sp|O94479|PFF1_SCHPO Vacuolar membrane protease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1919.12c PE=3 SV=1 45 1007 8.0E-66
sp|B0DC53|PFF1_LACBS Vacuolar membrane protease OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_294465 PE=3 SV=1 8 573 6.0E-64
sp|Q6CDE6|PFF1_YARLI Vacuolar membrane protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0C01133g PE=3 SV=1 29 1008 2.0E-63
sp|A7TM20|PFF1_VANPO Vacuolar membrane protease OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1052p9 PE=3 SV=1 51 1007 1.0E-62
sp|C4R628|PFF1_PICPG Vacuolar membrane protease OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr3_0953 PE=3 SV=1 7 611 9.0E-62
sp|A6QS12|PFF1_AJECN Vacuolar membrane protease OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_00168 PE=3 SV=1 5 237 3.0E-56
sp|A3LW86|PFF1_PICST Vacuolar membrane protease (Fragment) OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_46351 PE=3 SV=2 7 511 2.0E-53
sp|C4Y9H0|PFF1_CLAL4 Vacuolar membrane protease OS=Clavispora lusitaniae (strain ATCC 42720) GN=CLUG_04860 PE=3 SV=1 7 514 3.0E-52
sp|B9WCV6|PFF1_CANDC Vacuolar membrane protease OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_24500 PE=3 SV=1 51 562 7.0E-50
sp|A8N513|PFF1_COPC7 Vacuolar membrane protease OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_04591 PE=3 SV=2 7 388 1.0E-47
sp|C5M545|PFF1_CANTT Vacuolar membrane protease OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CTRG_02023 PE=3 SV=1 19 363 6.0E-46
sp|C4YS59|PFF1_CANAW Vacuolar membrane protease OS=Candida albicans (strain WO-1) GN=CAWG_04918 PE=3 SV=1 51 350 1.0E-43
sp|Q59RF7|PFF1_CANAL Vacuolar membrane protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2163 PE=3 SV=1 51 350 2.0E-43
sp|A5DDN8|PFF1_PICGU Vacuolar membrane protease OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_01389 PE=3 SV=2 18 403 5.0E-42
sp|Q3UVK0|ERMP1_MOUSE Endoplasmic reticulum metallopeptidase 1 OS=Mus musculus GN=Ermp1 PE=1 SV=2 164 563 5.0E-28
sp|Q7Z2K6|ERMP1_HUMAN Endoplasmic reticulum metallopeptidase 1 OS=Homo sapiens GN=ERMP1 PE=1 SV=2 164 436 6.0E-28
sp|Q6UPR8|ERMP1_RAT Endoplasmic reticulum metallopeptidase 1 OS=Rattus norvegicus GN=Ermp1 PE=1 SV=1 177 436 2.0E-27
sp|Q0VGW4|ERMP1_XENLA Endoplasmic reticulum metallopeptidase 1 OS=Xenopus laevis GN=ermp1 PE=2 SV=1 164 342 6.0E-27
sp|Q09216|ERP1A_CAEEL Putative endoplasmic reticulum metallopeptidase 1-A OS=Caenorhabditis elegans GN=B0495.7 PE=1 SV=2 142 333 2.0E-26
sp|O94702|ERMP1_SCHPO Putative endoplasmic reticulum metallopeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erm1 PE=3 SV=1 151 332 9.0E-26
sp|A8N513|PFF1_COPC7 Vacuolar membrane protease OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_04591 PE=3 SV=2 456 1001 2.0E-22
sp|Q18600|ERP1B_CAEEL Putative endoplasmic reticulum metallopeptidase 1-B OS=Caenorhabditis elegans GN=C44B7.11 PE=1 SV=4 172 399 2.0E-19
sp|B0DC53|PFF1_LACBS Vacuolar membrane protease OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_294465 PE=3 SV=1 679 1001 2.0E-18
sp|A3LW86|PFF1_PICST Vacuolar membrane protease (Fragment) OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_46351 PE=3 SV=2 662 1008 6.0E-18
sp|C4YS59|PFF1_CANAW Vacuolar membrane protease OS=Candida albicans (strain WO-1) GN=CAWG_04918 PE=3 SV=1 676 1007 2.0E-16
sp|B9WCV6|PFF1_CANDC Vacuolar membrane protease OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_24500 PE=3 SV=1 677 1009 4.0E-16
sp|A5DDN8|PFF1_PICGU Vacuolar membrane protease OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_01389 PE=3 SV=2 676 1007 4.0E-14
sp|Q59RF7|PFF1_CANAL Vacuolar membrane protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2163 PE=3 SV=1 676 1007 1.0E-13
sp|C5M545|PFF1_CANTT Vacuolar membrane protease OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CTRG_02023 PE=3 SV=1 677 1009 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 15 32 17
2 402 424 22
3 453 475 22
4 482 504 22
5 519 538 19
6 545 567 22
7 678 700 22
8 712 734 22
9 744 766 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8334
MKLGNPFGFGPGPVTFWTTVVYLAILISVIYVHETVPPAPADDALAGGLNLTEAWVDLQTITKAYHPYNSRENDD
VRRYLLERAAQILDRNGMSYTLERNKAANGGFVAGSADNTPGAAIFDDGVSNVTYTYQTATEWVGEYFEGSNVYV
YIRGKEDPRGNWWISQQAADAKRRNGGVLVNCHFDSVSTGYGATDDGMACVTMLQLLSYFTSKGRQPNNGIVLLF
NNAEEDGLLGARAFGNSPLLDFCHTFVNLEGAGAGGRAMLFRTTDLETAKAYSGSPHPFGSVVAANAFEQGIIRS
DTDYSVFAKVFGQRGMDIAFYQPRSRYHTQEDDVRHTSTDSVWHMLSAALASTESLSATTGTDFHGPRSDGRKDL
PQNGRPTEGVWFDLFGSAWAAFPLRGLFAWSLTLLVATPLVLLLITYLLARNDRVYFFAKDVDGTEGDPIALRGW
RGFFRFPLALLVAAGLTVASVLLVAKLNPLIIHSSSYAVWAMTMSLFYSTFWLMARGASFVRPSALQRGFAVLWL
YVLCWAFQVLAAVAEDRLHIGALYFAAFLHTAAFVSLTVSLLEQSALPAKHDFALRLVDEGREAGSSQSSADEEG
EEQSRQGHEEDDEADDATETTPLRAGEAGHDSNNNNTTFASTYRRSVAAEASSSTPKQQDRPPYEGEQAWSDRLP
SWTWFLQLLLLAPVHLMIVGNLGLVQTSSMAMTGPDGNNLLIPLMAVGITGMLLLLPLTPFLHRVTHHIPLFLLA
VFVGTLIYNLVAFPFSATSRFKFRFQQTVDLDKGTNVVSITGLDKFVRPVVASVPTAAGQQIACPASPVRGLVDC
QYDASALPPDPVEGTKLEDLLTVEATKSKDGRSARVGIHAEGTRLCYVDLSKPVFGFSVEGGGSRDGRFGPSPGD
GFSHLQLWRRDWEGAWNVSLQLVDRGGFSPPQRSANGEEAIVGELKPRSATTPLDDEALQVAVRCVWNDANSAAT
SMPAFWELLRFMPDWSIVTKTTIGLVSVRRSVRAV
Coding >Ophio5|8334
ATGAAGCTCGGTAATCCGTTTGGCTTCGGGCCCGGCCCCGTCACCTTCTGGACAACGGTCGTCTACCTCGCCATC
CTGATTTCGGTCATTTACGTGCACGAGACGGTCCCTCCCGCGCCGGCTGACGATGCCCTCGCTGGCGGCCTCAAT
CTGACGGAGGCGTGGGTGGACCTTCAGACTATTACCAAGGCGTATCATCCTTACAACAGCCGCGAGAATGACGAC
GTACGCCGCTATCTCCTCGAGCGCGCTGCTCAGATCTTGGACCGCAACGGCATGAGCTACACCCTGGAGCGGAAC
AAGGCTGCGAACGGTGGCTTCGTGGCTGGGTCCGCTGACAACACTCCCGGAGCTGCCATTTTCGACGATGGTGTC
TCCAACGTAACTTATACCTATCAGACTGCCACGGAATGGGTTGGCGAGTACTTTGAAGGCAGCAACGTGTACGTC
TACATCCGCGGCAAGGAAGACCCCCGTGGCAACTGGTGGATTTCACAACAGGCGGCGGATGCCAAGCGTCGCAAC
GGTGGCGTGCTCGTCAACTGCCACTTTGACTCGGTCTCGACCGGTTATGGTGCGACTGACGACGGCATGGCCTGC
GTGACCATGCTCCAGCTCCTGAGCTACTTTACGTCCAAAGGCCGGCAGCCCAACAACGGCATCGTCCTGCTCTTC
AACAACGCCGAGGAGGACGGGCTGCTCGGGGCGCGGGCATTTGGCAACAGCCCTTTGCTCGACTTCTGTCATACG
TTTGTCAACCTCGAGGGTGCCGGCGCCGGCGGCCGTGCTATGTTATTTCGCACGACGGACCTCGAGACAGCCAAG
GCATACTCGGGAAGTCCGCATCCGTTCGGGTCCGTCGTGGCGGCCAACGCGTTTGAACAAGGCATCATCAGGAGC
GATACCGACTACTCCGTCTTTGCCAAAGTCTTTGGTCAGCGCGGAATGGACATCGCCTTTTACCAGCCTCGGTCG
CGGTACCATACGCAAGAGGACGACGTGCGCCATACGTCGACGGACAGCGTCTGGCACATGCTCTCTGCAGCGTTG
GCGTCCACGGAGAGCCTGTCGGCCACCACAGGCACCGACTTTCATGGCCCTCGCTCTGATGGGAGGAAGGACCTC
CCGCAGAACGGCAGGCCGACCGAAGGCGTCTGGTTCGACCTCTTCGGCAGCGCGTGGGCGGCGTTTCCGCTTAGA
GGGCTGTTTGCCTGGTCCCTGACGCTGCTGGTGGCGACGCCGCTGGTGCTTCTCCTCATAACCTACCTGTTGGCT
CGCAACGATAGGGTTTATTTCTTTGCCAAGGACGTCGACGGCACCGAGGGCGACCCCATTGCGCTCAGGGGCTGG
AGGGGCTTCTTTCGCTTTCCGCTGGCACTGCTGGTCGCGGCTGGCCTTACCGTCGCGTCGGTCTTACTGGTGGCG
AAGCTGAATCCGCTCATCATCCATAGCAGCAGCTACGCGGTATGGGCCATGACCATGTCGCTGTTCTACTCGACT
TTCTGGCTGATGGCGCGCGGCGCCAGCTTCGTCCGTCCCAGCGCTCTGCAGCGAGGCTTTGCCGTGCTGTGGCTG
TACGTCCTCTGCTGGGCTTTCCAGGTTCTGGCGGCTGTGGCCGAGGACCGGCTGCATATCGGGGCCCTGTACTTT
GCTGCCTTTTTGCACACAGCCGCCTTTGTGAGCCTTACTGTGTCTCTGCTGGAGCAGTCTGCGCTGCCGGCCAAG
CACGACTTTGCGCTTCGGCTGGTTGACGAGGGCCGAGAGGCCGGCTCGAGCCAGAGCTCGGCGGACGAGGAGGGC
GAAGAGCAGAGCCGCCAGGGCCACGAGGAAGACGACGAGGCCGATGATGCAACGGAGACGACGCCGCTGCGGGCC
GGCGAAGCGGGCCACGACTCCAACAACAACAACACGACATTTGCCAGCACCTACCGGCGGTCCGTGGCCGCCGAG
GCGTCATCGTCGACTCCCAAGCAGCAAGACCGGCCGCCCTACGAAGGCGAGCAGGCCTGGTCCGACCGTCTTCCG
TCGTGGACCTGGTTCTTGCAGCTGCTTCTCCTGGCGCCGGTGCACCTGATGATAGTGGGCAACCTCGGCCTCGTG
CAGACGTCGTCGATGGCCATGACGGGCCCTGACGGGAACAATCTGCTCATCCCGCTCATGGCCGTGGGCATCACG
GGCATGCTTTTGCTGCTGCCACTGACTCCCTTTTTGCACCGGGTGACGCATCACATACCTCTCTTTCTCCTCGCC
GTCTTTGTCGGCACTCTCATCTACAATCTGGTGGCGTTTCCGTTTTCTGCCACGAGCCGGTTCAAGTTTCGCTTC
CAGCAGACGGTGGACCTCGACAAAGGCACCAACGTCGTCAGCATCACAGGGCTGGACAAGTTTGTTAGACCTGTT
GTCGCGTCCGTGCCGACGGCGGCGGGACAGCAGATTGCCTGTCCCGCGTCGCCGGTCCGGGGCCTCGTCGACTGT
CAGTACGACGCGTCGGCCCTGCCTCCCGATCCCGTCGAGGGGACGAAACTGGAGGATTTGCTGACTGTCGAGGCG
ACGAAATCGAAAGACGGCCGCAGCGCGAGGGTGGGGATCCACGCCGAGGGGACGAGGCTGTGCTACGTGGACCTC
TCGAAGCCTGTCTTTGGATTCAGCGTCGAGGGCGGAGGCAGCAGAGACGGACGGTTCGGCCCGTCTCCTGGCGAT
GGCTTCAGCCACCTCCAGCTCTGGCGGCGAGACTGGGAGGGGGCGTGGAACGTGTCGCTTCAGCTCGTCGACCGA
GGCGGCTTCTCCCCTCCTCAACGGTCCGCGAACGGTGAGGAGGCGATAGTGGGCGAGCTCAAGCCGAGGTCGGCC
ACGACGCCTCTGGACGACGAGGCGCTTCAAGTGGCGGTGCGGTGTGTCTGGAACGACGCCAACTCGGCGGCGACG
TCGATGCCGGCGTTTTGGGAGTTGTTGCGCTTCATGCCTGACTGGAGCATCGTGACGAAGACGACGATCGGCTTG
GTCTCTGTGAGGAGGAGTGTGAGGGCTGTG
Transcript >Ophio5|8334
ATGAAGCTCGGTAATCCGTTTGGCTTCGGGCCCGGCCCCGTCACCTTCTGGACAACGGTCGTCTACCTCGCCATC
CTGATTTCGGTCATTTACGTGCACGAGACGGTCCCTCCCGCGCCGGCTGACGATGCCCTCGCTGGCGGCCTCAAT
CTGACGGAGGCGTGGGTGGACCTTCAGACTATTACCAAGGCGTATCATCCTTACAACAGCCGCGAGAATGACGAC
GTACGCCGCTATCTCCTCGAGCGCGCTGCTCAGATCTTGGACCGCAACGGCATGAGCTACACCCTGGAGCGGAAC
AAGGCTGCGAACGGTGGCTTCGTGGCTGGGTCCGCTGACAACACTCCCGGAGCTGCCATTTTCGACGATGGTGTC
TCCAACGTAACTTATACCTATCAGACTGCCACGGAATGGGTTGGCGAGTACTTTGAAGGCAGCAACGTGTACGTC
TACATCCGCGGCAAGGAAGACCCCCGTGGCAACTGGTGGATTTCACAACAGGCGGCGGATGCCAAGCGTCGCAAC
GGTGGCGTGCTCGTCAACTGCCACTTTGACTCGGTCTCGACCGGTTATGGTGCGACTGACGACGGCATGGCCTGC
GTGACCATGCTCCAGCTCCTGAGCTACTTTACGTCCAAAGGCCGGCAGCCCAACAACGGCATCGTCCTGCTCTTC
AACAACGCCGAGGAGGACGGGCTGCTCGGGGCGCGGGCATTTGGCAACAGCCCTTTGCTCGACTTCTGTCATACG
TTTGTCAACCTCGAGGGTGCCGGCGCCGGCGGCCGTGCTATGTTATTTCGCACGACGGACCTCGAGACAGCCAAG
GCATACTCGGGAAGTCCGCATCCGTTCGGGTCCGTCGTGGCGGCCAACGCGTTTGAACAAGGCATCATCAGGAGC
GATACCGACTACTCCGTCTTTGCCAAAGTCTTTGGTCAGCGCGGAATGGACATCGCCTTTTACCAGCCTCGGTCG
CGGTACCATACGCAAGAGGACGACGTGCGCCATACGTCGACGGACAGCGTCTGGCACATGCTCTCTGCAGCGTTG
GCGTCCACGGAGAGCCTGTCGGCCACCACAGGCACCGACTTTCATGGCCCTCGCTCTGATGGGAGGAAGGACCTC
CCGCAGAACGGCAGGCCGACCGAAGGCGTCTGGTTCGACCTCTTCGGCAGCGCGTGGGCGGCGTTTCCGCTTAGA
GGGCTGTTTGCCTGGTCCCTGACGCTGCTGGTGGCGACGCCGCTGGTGCTTCTCCTCATAACCTACCTGTTGGCT
CGCAACGATAGGGTTTATTTCTTTGCCAAGGACGTCGACGGCACCGAGGGCGACCCCATTGCGCTCAGGGGCTGG
AGGGGCTTCTTTCGCTTTCCGCTGGCACTGCTGGTCGCGGCTGGCCTTACCGTCGCGTCGGTCTTACTGGTGGCG
AAGCTGAATCCGCTCATCATCCATAGCAGCAGCTACGCGGTATGGGCCATGACCATGTCGCTGTTCTACTCGACT
TTCTGGCTGATGGCGCGCGGCGCCAGCTTCGTCCGTCCCAGCGCTCTGCAGCGAGGCTTTGCCGTGCTGTGGCTG
TACGTCCTCTGCTGGGCTTTCCAGGTTCTGGCGGCTGTGGCCGAGGACCGGCTGCATATCGGGGCCCTGTACTTT
GCTGCCTTTTTGCACACAGCCGCCTTTGTGAGCCTTACTGTGTCTCTGCTGGAGCAGTCTGCGCTGCCGGCCAAG
CACGACTTTGCGCTTCGGCTGGTTGACGAGGGCCGAGAGGCCGGCTCGAGCCAGAGCTCGGCGGACGAGGAGGGC
GAAGAGCAGAGCCGCCAGGGCCACGAGGAAGACGACGAGGCCGATGATGCAACGGAGACGACGCCGCTGCGGGCC
GGCGAAGCGGGCCACGACTCCAACAACAACAACACGACATTTGCCAGCACCTACCGGCGGTCCGTGGCCGCCGAG
GCGTCATCGTCGACTCCCAAGCAGCAAGACCGGCCGCCCTACGAAGGCGAGCAGGCCTGGTCCGACCGTCTTCCG
TCGTGGACCTGGTTCTTGCAGCTGCTTCTCCTGGCGCCGGTGCACCTGATGATAGTGGGCAACCTCGGCCTCGTG
CAGACGTCGTCGATGGCCATGACGGGCCCTGACGGGAACAATCTGCTCATCCCGCTCATGGCCGTGGGCATCACG
GGCATGCTTTTGCTGCTGCCACTGACTCCCTTTTTGCACCGGGTGACGCATCACATACCTCTCTTTCTCCTCGCC
GTCTTTGTCGGCACTCTCATCTACAATCTGGTGGCGTTTCCGTTTTCTGCCACGAGCCGGTTCAAGTTTCGCTTC
CAGCAGACGGTGGACCTCGACAAAGGCACCAACGTCGTCAGCATCACAGGGCTGGACAAGTTTGTTAGACCTGTT
GTCGCGTCCGTGCCGACGGCGGCGGGACAGCAGATTGCCTGTCCCGCGTCGCCGGTCCGGGGCCTCGTCGACTGT
CAGTACGACGCGTCGGCCCTGCCTCCCGATCCCGTCGAGGGGACGAAACTGGAGGATTTGCTGACTGTCGAGGCG
ACGAAATCGAAAGACGGCCGCAGCGCGAGGGTGGGGATCCACGCCGAGGGGACGAGGCTGTGCTACGTGGACCTC
TCGAAGCCTGTCTTTGGATTCAGCGTCGAGGGCGGAGGCAGCAGAGACGGACGGTTCGGCCCGTCTCCTGGCGAT
GGCTTCAGCCACCTCCAGCTCTGGCGGCGAGACTGGGAGGGGGCGTGGAACGTGTCGCTTCAGCTCGTCGACCGA
GGCGGCTTCTCCCCTCCTCAACGGTCCGCGAACGGTGAGGAGGCGATAGTGGGCGAGCTCAAGCCGAGGTCGGCC
ACGACGCCTCTGGACGACGAGGCGCTTCAAGTGGCGGTGCGGTGTGTCTGGAACGACGCCAACTCGGCGGCGACG
TCGATGCCGGCGTTTTGGGAGTTGTTGCGCTTCATGCCTGACTGGAGCATCGTGACGAAGACGACGATCGGCTTG
GTCTCTGTGAGGAGGAGTGTGAGGGCTGTGTGA
Gene >Ophio5|8334
ATGAAGCTCGGTAATCCGTTTGGCTTCGGGCCCGGCCCCGTCACCTTCTGGACAACGGTCGTCTACCTCGCCATC
CTGATTTCGGTCATTTACGTGCACGAGACGGTCCCTCCCGCGCCGGCTGACGATGCCCTCGCTGGCGGCCTCAAT
CTGACGGAGGCGTGGGTGGACCTTCAGACTATTACCAAGGCGTATCATCCTTACAACAGCCGCGAGAATGACGAC
GTACGCCGCTATCTCCTCGAGCGCGCTGCTCAGATCTTGGACCGCAACGGCATGAGCTACACCCTGGAGCGGAAC
AAGGCTGCGAACGGTGGCTTCGTGGCTGGGTCCGCTGACAACACTCCCGGAGCTGCCATTTTCGACGATGGTGTC
TCCAACGTAACTTATACCTATCAGACTGCCACGGAATGGGTTGGCGAGTACTTTGAAGGCAGCAACGTGTACGTC
TACATCCGCGGCAAGGAAGACCCCCGTGGCAACTGGTGGATTTCACAACAGGCGGCGGATGCCAAGCGTCGCAAC
GGTGGCGTGCTCGTCAACTGCCACTTTGACTCGGTCTCGACCGGTTATGGTGCGACTGACGACGGCATGGCCTGC
GTGACCATGCTCCAGCTCCTGAGCTACTTTACGTCCAAAGGCCGGCAGCCCAACAACGGCATCGTCCTGCTCTTC
AACAACGCCGAGGAGGACGGGCTGCTCGGGGCGCGGGCATTTGGCAACAGCCCTTTGCTCGACTTCTGTCATACG
TTTGTCAACCTCGAGGGTGCCGGCGCCGGCGGCCGTGCTATGTTATTTCGCACGACGGACCTCGAGACAGCCAAG
GCATACTCGGGAAGTCCGCATCCGTTCGGGTCCGTCGTGGCGGCCAACGCGTTTGAACAAGGCATCATCAGGAGC
GATACCGACTACTCCGTCTTTGCCAAAGTCTTTGGTCAGCGCGGAATGGACATCGCCTTTTACCAGCCTCGGTCG
CGGTACCATACGCAAGAGGACGACGTGCGCCATACGTCGACGGACAGCGTCTGGCACATGCTCTCTGCAGCGTTG
GCGTCCACGGAGAGCCTGTCGGCCACCACAGGCACCGACTTTCATGGCCCTCGCTCTGATGGGAGGAAGGACCTC
CCGCAGAACGGCAGGCCGACCGAAGGCGTCTGGTTCGACCTCTTCGGCAGCGCGTGGGCGGCGTTTCCGCTTAGA
GGGCTGTTTGCCTGGTCCCTGACGCTGCTGGTGGCGACGCCGCTGGTGCTTCTCCTCATAACCTACCTGTTGGCT
CGCAACGATAGGGTTTATTTCTTTGCCAAGGACGTCGACGGCACCGAGGGCGACCCCATTGCGCTCAGGGGCTGG
AGGGGCTTCTTTCGCTTTCCGCTGGCACTGCTGGTCGCGGCTGGCCTTACCGTCGCGTCGGTCTTACTGGTGGCG
AAGCTGAATCCGCTCATCATCCATAGCAGCAGCTACGCGGTGTGAGTTTTTTCCCCTCGAGAAGGCATCTTGTTC
GAAGCTGACGAGAGGCGTAGATGGGCCATGACCATGTCGCTGTTCTACTCGACTTTCTGGCTGATGGCGCGCGGC
GCCAGCTTCGTCCGTCCCAGCGCTCTGCAGCGAGGCTTTGCCGTGCTGTGGCTGTACGTCCTCTGCTGGGCTTTC
CAGGTTCTGGCGGCTGTGGCCGAGGACCGGCTGCATATCGGGGCCCTGTACTTTGCTGCCTTTTTGCACACAGCC
GCCTTTGTGAGCCTTACTGTGTCTCTGCTGGAGCAGTCTGCGCTGCCGGCCAAGCACGACTTTGCGCTTCGGCTG
GTTGACGAGGGCCGAGAGGCCGGCTCGAGCCAGAGCTCGGCGGACGAGGAGGGCGAAGAGCAGAGCCGCCAGGGC
CACGAGGAAGACGACGAGGCCGATGATGCAACGGAGACGACGCCGCTGCGGGCCGGCGAAGCGGGCCACGACTCC
AACAACAACAACACGACATTTGCCAGCACCTACCGGCGGTCCGTGGCCGCCGAGGCGTCATCGTCGACTCCCAAG
CAGCAAGACCGGCCGCCCTACGAAGGCGAGCAGGCCTGGTCCGACCGTCTTCCGTCGTGGACCTGGTTCTTGCAG
CTGCTTCTCCTGGCGCCGGTGCACCTGATGATAGTGGGCAACCTCGGCCTCGTGCAGACGTCGTCGATGGCCATG
ACGGGCCCTGACGGGAACAATCTGCTCATCCCGCTCATGGCCGTGGGCATCACGGGCATGCTTTTGCTGCTGCCA
CTGACTCCCTTTTTGCACCGGGTGACGCATCACATACCTCTCTTTCTCCTCGCCGTCTTTGTCGGCACTCTCATC
TACAATCTGGTGGCGTTTCCGTTTTCTGCCACGAGCCGGTTCAAGTTTCGCTTCCAGCAGACGGTGGACCTCGAC
AAAGGCACCAACGTCGTCAGCATCACAGGGCTGGACAAGTTTGTTAGACCTGTTGTCGCGTCCGTGCCGACGGCG
GCGGGACAGCAGATTGCCTGTCCCGCGTCGCCGGTCCGGGGCCTCGTCGACTGTCAGTACGACGCGTCGGCCCTG
CCTCCCGATCCCGTCGAGGGGACGAAACTGGAGGATTTGCTGACTGTCGAGGCGACGAAATCGAAAGACGGCCGC
AGCGCGAGGGTGGGGATCCACGCCGAGGGGACGAGGCTGTGCTACGTGGACCTCTCGAAGCCTGTCTTTGGATTC
AGCGTCGAGGGCGGAGGCAGCAGAGACGGACGGTTCGGCCCGTCTCCTGGCGATGGCTTCAGCCACCTCCAGCTC
TGGCGGCGAGACTGGGAGGGGGCGTGGAACGTGTCGCTTCAGCTCGTCGACCGAGGCGGCTTCTCCCCTCCTCAA
CGGTCCGCGAACGGTGAGGAGGCGATAGTGGGCGAGCTCAAGCCGAGGTCGGCCACGACGCCTCTGGACGACGAG
GCGCTTCAAGTGGCGGTGCGGTGTGTCTGGAACGACGCCAACTCGGCGGCGACGTCGATGCCGGCGTTTTGGGAG
TTGTTGCGCTTCATGCCTGACTGGAGCATCGTGACGAAGACGACGATCGGCTTGGTCTCTGTGAGGAGGAGTGTG
AGGGCTGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail