Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8329
Gene name
Locationscaffold_91:9281..10415
Strand-
Gene length (bp)1134
Transcript length (bp)1134
Coding sequence length (bp)1131
Protein length (aa) 377

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20246 DUF6601 Family of unknown function (DUF6601) 3.2E-74 81 325

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Endoplasmic reticulum Signal peptide|Transmembrane domain 0.0907 0.0268 0.1635 0.6198 0.226 0.0609 0.6567 0.5425 0.6146 0.0175

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 278 300 22
2 313 335 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup798
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|876
Ophiocordyceps australis map64 (Brazil) OphauB2|1463
Ophiocordyceps camponoti-floridani Ophcf2|02782
Ophiocordyceps camponoti-rufipedis Ophun1|4817
Ophiocordyceps kimflemingae Ophio5|8329 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3480
Ophiocordyceps subramaniannii Hirsu2|8260

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8329
MSTGVGEESIPRQPTSRLSMSSRAPPFSVQAPTTAAASATSTQLENGRDQATDAWPASYHYYKDGSERKPLRAVA
NPVDDVDNFLEAQFSLGRLNGMLKHLWFAGSRRPAMQLHFQVAMGRQIVLADRMDLHLLWDSTGRLFMKPLPTFL
LSPSDSPTSAGKDEALLLRCSETARSVALGFLYTYACLICSETDFHMANQMYLLPRKDDDSTIKWTAWKKLAREI
LRMHDVEKVHPRFQRAELRMSRLNTIHRLTGLSAFDPDVSSWNNYSSLFLDNLTWISAATILIALVLTAMQVGLA
TDRLKGDQGFQRASYGFTVFAILGPMCAFGLVVLAALLNLTMDLPVLFRDMRALARASVHGRGHQRGTGGTSSGL
PP
Coding >Ophio5|8329
ATGTCTACCGGTGTAGGCGAAGAAAGTATTCCAAGACAGCCGACTAGTCGCCTATCGATGTCTTCACGGGCGCCC
CCCTTTTCTGTCCAAGCCCCGACAACGGCAGCCGCAAGCGCCACCTCGACCCAGCTGGAAAACGGGCGGGATCAA
GCCACGGACGCCTGGCCAGCGTCCTACCACTACTACAAGGATGGCAGTGAGAGGAAACCGCTACGGGCTGTCGCC
AACCCCGTTGACGACGTGGACAACTTCCTGGAGGCTCAGTTCTCCCTCGGAAGACTGAATGGGATGCTCAAGCAT
CTATGGTTTGCCGGGTCACGGCGTCCAGCCATGCAACTGCACTTTCAGGTAGCCATGGGCCGTCAAATCGTCCTT
GCCGACCGGATGGACTTACACCTACTCTGGGACAGCACCGGGAGACTGTTTATGAAGCCTCTCCCGACCTTTCTT
CTCAGTCCAAGCGACAGCCCTACGTCGGCTGGCAAGGACGAGGCGCTTTTGCTCCGATGCAGCGAAACTGCGCGG
AGTGTAGCTCTGGGATTTCTCTACACGTATGCCTGTCTCATATGTTCGGAGACGGACTTCCACATGGCGAATCAG
ATGTATCTCTTACCTCGAAAAGACGATGACTCGACAATCAAGTGGACCGCCTGGAAGAAGCTGGCCCGGGAGATC
CTCCGAATGCACGACGTGGAAAAGGTCCACCCACGCTTCCAGCGCGCTGAACTCCGCATGTCTCGCCTGAACACT
ATTCATCGCCTGACTGGCCTATCAGCCTTCGACCCGGACGTTAGCAGCTGGAACAACTACAGTAGCCTCTTCCTA
GATAATCTGACCTGGATATCGGCAGCCACCATCCTCATCGCCCTCGTGCTGACGGCGATGCAGGTCGGTCTCGCT
ACCGACCGGCTCAAGGGGGACCAAGGCTTCCAGCGAGCTTCCTACGGCTTCACCGTCTTCGCCATACTGGGACCC
ATGTGTGCATTCGGCTTGGTGGTCCTGGCGGCACTACTCAATCTGACCATGGACTTACCAGTGCTTTTCCGGGAC
ATGCGGGCACTGGCTCGGGCTTCGGTCCACGGTCGGGGCCACCAGCGAGGTACTGGGGGGACCAGTTCTGGGTTG
CCACCA
Transcript >Ophio5|8329
ATGTCTACCGGTGTAGGCGAAGAAAGTATTCCAAGACAGCCGACTAGTCGCCTATCGATGTCTTCACGGGCGCCC
CCCTTTTCTGTCCAAGCCCCGACAACGGCAGCCGCAAGCGCCACCTCGACCCAGCTGGAAAACGGGCGGGATCAA
GCCACGGACGCCTGGCCAGCGTCCTACCACTACTACAAGGATGGCAGTGAGAGGAAACCGCTACGGGCTGTCGCC
AACCCCGTTGACGACGTGGACAACTTCCTGGAGGCTCAGTTCTCCCTCGGAAGACTGAATGGGATGCTCAAGCAT
CTATGGTTTGCCGGGTCACGGCGTCCAGCCATGCAACTGCACTTTCAGGTAGCCATGGGCCGTCAAATCGTCCTT
GCCGACCGGATGGACTTACACCTACTCTGGGACAGCACCGGGAGACTGTTTATGAAGCCTCTCCCGACCTTTCTT
CTCAGTCCAAGCGACAGCCCTACGTCGGCTGGCAAGGACGAGGCGCTTTTGCTCCGATGCAGCGAAACTGCGCGG
AGTGTAGCTCTGGGATTTCTCTACACGTATGCCTGTCTCATATGTTCGGAGACGGACTTCCACATGGCGAATCAG
ATGTATCTCTTACCTCGAAAAGACGATGACTCGACAATCAAGTGGACCGCCTGGAAGAAGCTGGCCCGGGAGATC
CTCCGAATGCACGACGTGGAAAAGGTCCACCCACGCTTCCAGCGCGCTGAACTCCGCATGTCTCGCCTGAACACT
ATTCATCGCCTGACTGGCCTATCAGCCTTCGACCCGGACGTTAGCAGCTGGAACAACTACAGTAGCCTCTTCCTA
GATAATCTGACCTGGATATCGGCAGCCACCATCCTCATCGCCCTCGTGCTGACGGCGATGCAGGTCGGTCTCGCT
ACCGACCGGCTCAAGGGGGACCAAGGCTTCCAGCGAGCTTCCTACGGCTTCACCGTCTTCGCCATACTGGGACCC
ATGTGTGCATTCGGCTTGGTGGTCCTGGCGGCACTACTCAATCTGACCATGGACTTACCAGTGCTTTTCCGGGAC
ATGCGGGCACTGGCTCGGGCTTCGGTCCACGGTCGGGGCCACCAGCGAGGTACTGGGGGGACCAGTTCTGGGTTG
CCACCATGA
Gene >Ophio5|8329
ATGTCTACCGGTGTAGGCGAAGAAAGTATTCCAAGACAGCCGACTAGTCGCCTATCGATGTCTTCACGGGCGCCC
CCCTTTTCTGTCCAAGCCCCGACAACGGCAGCCGCAAGCGCCACCTCGACCCAGCTGGAAAACGGGCGGGATCAA
GCCACGGACGCCTGGCCAGCGTCCTACCACTACTACAAGGATGGCAGTGAGAGGAAACCGCTACGGGCTGTCGCC
AACCCCGTTGACGACGTGGACAACTTCCTGGAGGCTCAGTTCTCCCTCGGAAGACTGAATGGGATGCTCAAGCAT
CTATGGTTTGCCGGGTCACGGCGTCCAGCCATGCAACTGCACTTTCAGGTAGCCATGGGCCGTCAAATCGTCCTT
GCCGACCGGATGGACTTACACCTACTCTGGGACAGCACCGGGAGACTGTTTATGAAGCCTCTCCCGACCTTTCTT
CTCAGTCCAAGCGACAGCCCTACGTCGGCTGGCAAGGACGAGGCGCTTTTGCTCCGATGCAGCGAAACTGCGCGG
AGTGTAGCTCTGGGATTTCTCTACACGTATGCCTGTCTCATATGTTCGGAGACGGACTTCCACATGGCGAATCAG
ATGTATCTCTTACCTCGAAAAGACGATGACTCGACAATCAAGTGGACCGCCTGGAAGAAGCTGGCCCGGGAGATC
CTCCGAATGCACGACGTGGAAAAGGTCCACCCACGCTTCCAGCGCGCTGAACTCCGCATGTCTCGCCTGAACACT
ATTCATCGCCTGACTGGCCTATCAGCCTTCGACCCGGACGTTAGCAGCTGGAACAACTACAGTAGCCTCTTCCTA
GATAATCTGACCTGGATATCGGCAGCCACCATCCTCATCGCCCTCGTGCTGACGGCGATGCAGGTCGGTCTCGCT
ACCGACCGGCTCAAGGGGGACCAAGGCTTCCAGCGAGCTTCCTACGGCTTCACCGTCTTCGCCATACTGGGACCC
ATGTGTGCATTCGGCTTGGTGGTCCTGGCGGCACTACTCAATCTGACCATGGACTTACCAGTGCTTTTCCGGGAC
ATGCGGGCACTGGCTCGGGCTTCGGTCCACGGTCGGGGCCACCAGCGAGGTACTGGGGGGACCAGTTCTGGGTTG
CCACCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail