Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|8312
Gene name
Locationscaffold_902:607..1506
Strand+
Gene length (bp)899
Transcript length (bp)729
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03798 TRAM_LAG1_CLN8 TLC domain 2.4E-30 74 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13752|YF22_SCHPO Uncharacterized TLC domain-containing protein C17A2.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.02c PE=3 SV=1 13 203 3.0E-51
sp|P47153|TDA4_YEAST Topoisomerase I damage affected protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA4 PE=1 SV=1 32 198 3.0E-17
sp|Q5XIY2|TM56B_DANRE Transmembrane protein 56-B OS=Danio rerio GN=tmem56b PE=2 SV=1 32 189 1.0E-11
sp|Q06107|YP114_YEAST Uncharacterized TLC domain-containing protein YPR114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR114W PE=1 SV=1 61 187 3.0E-11
sp|Q96MV1|TMM56_HUMAN Transmembrane protein 56 OS=Homo sapiens GN=TMEM56 PE=1 SV=1 42 203 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13752|YF22_SCHPO Uncharacterized TLC domain-containing protein C17A2.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.02c PE=3 SV=1 13 203 3.0E-51
sp|P47153|TDA4_YEAST Topoisomerase I damage affected protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA4 PE=1 SV=1 32 198 3.0E-17
sp|Q5XIY2|TM56B_DANRE Transmembrane protein 56-B OS=Danio rerio GN=tmem56b PE=2 SV=1 32 189 1.0E-11
sp|Q06107|YP114_YEAST Uncharacterized TLC domain-containing protein YPR114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR114W PE=1 SV=1 61 187 3.0E-11
sp|Q96MV1|TMM56_HUMAN Transmembrane protein 56 OS=Homo sapiens GN=TMEM56 PE=1 SV=1 42 203 8.0E-09
sp|Q55BP8|TM56C_DICDI Transmembrane protein 56 homolog B OS=Dictyostelium discoideum GN=tmem56c PE=3 SV=1 58 202 3.0E-07
sp|Q8CGF5|TMM56_MOUSE Transmembrane protein 56 OS=Mus musculus GN=Tmem56 PE=2 SV=1 63 203 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 78 97 19
3 112 134 22
4 141 160 19
5 165 187 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|8312
MKDPFFIAPIPWLSESARPLCERLHLPSLPLHLHEVLAAALFYSFIFFPVSPILSSILAPRHYPKLPREKRLSWD
AHVVSMIQSTLIIVLAVWVILLDDERRAMDWEERVWGYTGAAGMVQALAAGYFLWDLIVTSHNFDVFGFGTLAHA
LAALLVYSLGFRPFVNYYGCVFILWELSTPFLNIHWFLDKTNRTGSRAQLYNGCRPQSNYGDEGFHNYGLCGRQC
CHSVLASRSLSGKQPHP
Coding >Ophio5|8312
ATGAAAGATCCGTTCTTCATAGCCCCAATCCCTTGGCTTTCGGAGTCGGCAAGGCCTTTGTGCGAACGCCTTCAC
TTGCCTTCTCTGCCTCTGCATTTACACGAAGTTCTTGCCGCTGCGCTCTTTTATTCATTTATCTTTTTTCCTGTC
TCCCCCATTCTTTCCAGCATCCTGGCGCCTCGCCATTATCCCAAACTACCACGCGAAAAGCGCTTGAGCTGGGAT
GCCCACGTTGTGTCCATGATCCAGAGCACTCTCATCATCGTACTCGCCGTCTGGGTCATACTTCTCGATGATGAG
CGTCGCGCCATGGATTGGGAAGAGCGTGTTTGGGGCTATACTGGCGCTGCCGGCATGGTCCAGGCCTTGGCCGCT
GGCTACTTTCTCTGGGACCTGATTGTAACCAGCCACAACTTCGATGTGTTTGGCTTCGGCACATTGGCTCATGCC
TTGGCCGCGTTACTCGTCTACTCTCTCGGCTTTAGACCTTTCGTCAATTACTATGGCTGCGTATTCATCCTCTGG
GAGCTTTCGACGCCTTTCTTAAACATTCACTGGTTCCTGGACAAAACGAACCGGACCGGATCTCGAGCACAGCTT
TACAATGGCTGTCGACCGCAGTCCAATTACGGTGACGAGGGATTCCACAACTATGGCCTTTGTGGACGACAATGC
TGCCATTCCGTATTGGCTAGCCGCTCTTTATCTGGCAAGCAACCTCACCCT
Transcript >Ophio5|8312
ATGAAAGATCCGTTCTTCATAGCCCCAATCCCTTGGCTTTCGGAGTCGGCAAGGCCTTTGTGCGAACGCCTTCAC
TTGCCTTCTCTGCCTCTGCATTTACACGAAGTTCTTGCCGCTGCGCTCTTTTATTCATTTATCTTTTTTCCTGTC
TCCCCCATTCTTTCCAGCATCCTGGCGCCTCGCCATTATCCCAAACTACCACGCGAAAAGCGCTTGAGCTGGGAT
GCCCACGTTGTGTCCATGATCCAGAGCACTCTCATCATCGTACTCGCCGTCTGGGTCATACTTCTCGATGATGAG
CGTCGCGCCATGGATTGGGAAGAGCGTGTTTGGGGCTATACTGGCGCTGCCGGCATGGTCCAGGCCTTGGCCGCT
GGCTACTTTCTCTGGGACCTGATTGTAACCAGCCACAACTTCGATGTGTTTGGCTTCGGCACATTGGCTCATGCC
TTGGCCGCGTTACTCGTCTACTCTCTCGGCTTTAGACCTTTCGTCAATTACTATGGCTGCGTATTCATCCTCTGG
GAGCTTTCGACGCCTTTCTTAAACATTCACTGGTTCCTGGACAAAACGAACCGGACCGGATCTCGAGCACAGCTT
TACAATGGCTGTCGACCGCAGTCCAATTACGGTGACGAGGGATTCCACAACTATGGCCTTTGTGGACGACAATGC
TGCCATTCCGTATTGGCTAGCCGCTCTTTATCTGGCAAGCAACCTCACCCTTAA
Gene >Ophio5|8312
ATGAAAGATCCGTTCTTCATAGCCCCAATCCCTTGGCTTTCGGAGTCGGCAAGGCCTTTGTGCGAACGCCTTCAC
TTGCCTTCTCTGCCTCTGCATTTACACGAAGTTCTTGCCGCTGCGCTCTTTTATTCATTTATCTTTTTTCCTGTC
TCCCCCATTCTTTCCAGCATCCTGGCGCCTCGCCATTATCCCAAACTACCACGCGAAAAGCGCTTGAGCTGGGAT
GCCCACGTTGTGTCCATGATCCAGAGCACTCTCATCATCGTACTCGCCGTCTGGGTCATACTTCTCGATGATGAG
CGTCGCGCCATGGATTGGGAAGAGCGTGTTTGGGGCTATACTGGCGCTGCCGGCATGGTCCAGGCCTTGGCCGCT
GGCTACTTTCTCTGGGACCTGATTGTAACCAGCCACAACTTCGATGTGTTTGGCTTCGGCACATTGGCTCATGCC
TTGGCCGCGTTACTCGTCTACTCTCTCGGCTTTGTATGAAACCTCCCCGTCTTGCCGCTCGCCACCATCACTACC
CGCTGTTGTCAGACTCTTGTACGTCAGCTAATGATACAGCAGAGACCTTTCGTCAATTACTATGGCTGCGTATTC
ATCCTCTGGGAGCTTTCGACGCCTTTCTTAAACATTCACTGGTTCCTGGACAAAACGAACCGGACCGGATCTCGA
GCACAGCTTTACAATGGGTACGTTCTACTTTTAACCTTCTTCTCCTGTCGCCTCGTCTACGGAACCTACCAATCA
ATACTTGTCTTCCGGGACATATGGGCAGCTGTCGACCGCAGTCCAATTACGGTGACGAGGGATTCCACAACTATG
GCCTTTGTGGACGACAATGCTGCCATTCCGTATTGGCTAGCCGCTCTTTATCTGGCAAGCAACCTCACCCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail