Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|831
Gene name
Locationscaffold_124:13898..16067
Strand-
Gene length (bp)2169
Transcript length (bp)2169
Coding sequence length (bp)2166
Protein length (aa) 722

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03068 PAD Protein-arginine deiminase (PAD) 9.8E-77 220 530
PF03068 PAD Protein-arginine deiminase (PAD) 1.1E-26 632 721

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ULC6|PADI1_HUMAN Protein-arginine deiminase type-1 OS=Homo sapiens GN=PADI1 PE=2 SV=2 221 526 1.0E-29
sp|O88806|PADI1_RAT Protein-arginine deiminase type-1 OS=Rattus norvegicus GN=Padi1 PE=2 SV=1 216 523 9.0E-27
sp|O02849|PADI3_SHEEP Protein-arginine deiminase type-3 OS=Ovis aries GN=PADI3 PE=1 SV=1 221 521 3.0E-26
sp|Q9Z185|PADI1_MOUSE Protein-arginine deiminase type-1 OS=Mus musculus GN=Padi1 PE=1 SV=1 221 523 4.0E-26
sp|Q9ULW8|PADI3_HUMAN Protein-arginine deiminase type-3 OS=Homo sapiens GN=PADI3 PE=1 SV=2 268 521 7.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ULC6|PADI1_HUMAN Protein-arginine deiminase type-1 OS=Homo sapiens GN=PADI1 PE=2 SV=2 221 526 1.0E-29
sp|O88806|PADI1_RAT Protein-arginine deiminase type-1 OS=Rattus norvegicus GN=Padi1 PE=2 SV=1 216 523 9.0E-27
sp|O02849|PADI3_SHEEP Protein-arginine deiminase type-3 OS=Ovis aries GN=PADI3 PE=1 SV=1 221 521 3.0E-26
sp|Q9Z185|PADI1_MOUSE Protein-arginine deiminase type-1 OS=Mus musculus GN=Padi1 PE=1 SV=1 221 523 4.0E-26
sp|Q9ULW8|PADI3_HUMAN Protein-arginine deiminase type-3 OS=Homo sapiens GN=PADI3 PE=1 SV=2 268 521 7.0E-26
sp|O88807|PADI4_RAT Protein-arginine deiminase type-4 OS=Rattus norvegicus GN=Padi4 PE=2 SV=1 221 523 1.0E-25
sp|Q9UM07|PADI4_HUMAN Protein-arginine deiminase type-4 OS=Homo sapiens GN=PADI4 PE=1 SV=2 221 533 1.0E-25
sp|Q08642|PADI2_MOUSE Protein-arginine deiminase type-2 OS=Mus musculus GN=Padi2 PE=1 SV=2 221 521 3.0E-25
sp|Q9Y2J8|PADI2_HUMAN Protein-arginine deiminase type-2 OS=Homo sapiens GN=PADI2 PE=1 SV=2 221 521 4.0E-25
sp|Q9Z183|PADI4_MOUSE Protein-arginine deiminase type-4 OS=Mus musculus GN=Padi4 PE=2 SV=3 221 524 7.0E-25
sp|Q9Z184|PADI3_MOUSE Protein-arginine deiminase type-3 OS=Mus musculus GN=Padi3 PE=1 SV=2 268 521 2.0E-24
sp|P70708|PADI3_RAT Protein-arginine deiminase type-3 OS=Rattus norvegicus GN=Padi3 PE=2 SV=1 268 521 2.0E-24
sp|P20717|PADI2_RAT Protein-arginine deiminase type-2 OS=Rattus norvegicus GN=Padi2 PE=1 SV=1 221 521 3.0E-24
sp|Q6TGC4|PADI6_HUMAN Protein-arginine deiminase type-6 OS=Homo sapiens GN=PADI6 PE=1 SV=3 355 528 4.0E-22
sp|Q8K3V4|PADI6_MOUSE Protein-arginine deiminase type-6 OS=Mus musculus GN=Padi6 PE=1 SV=2 355 528 1.0E-17
sp|Q9UM07|PADI4_HUMAN Protein-arginine deiminase type-4 OS=Homo sapiens GN=PADI4 PE=1 SV=2 633 715 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004668 protein-arginine deiminase activity Yes
GO:0005509 calcium ion binding Yes
GO:0005737 cytoplasm Yes
GO:0016787 hydrolase activity No
GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines No
GO:0046872 metal ion binding No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|831
MWNPIASSAVLIGHVALTRGAPFDVTGVSSTIFNDLNNPRIRNSSDTLLTVTILADTNRDGVVDTEGDSDYTRRR
TWTSDSGALFLANIVDTGRRCSLKIQKSTPNEELEYCHDATDNVLRNAKFLAPVRTLPVVTPALSDKATGSITVM
GKMAATKTRIFQKRGADWVYISSSHIFSAEELRAGLELGIDARDVRRPGGWDGKAMVQFTVKETGVVKAIDWVQM
RVAPVLIHNHLQKAEALFVQSAFMMNTHKNETAMRFNSAQAKFVRDIDTIAREAGLPLFQFNDITNHDIWVQDFF
EPGYMTIPGPDGPVGLRIMIRSAQRDRLGGRQVFQTLRSDTIGAVQHLVWGDTSDSMGNLETIPPYVHNGKRYPA
GRAVMGSQAGIRPFIMEFLRAQEEQDPIELDTTWLFIGHADEFMQFLPHDSERGWVLVVSDPQAGIKLLQDATLV
GHGGSNSHSRPIYPTDKESCFPASTIEDSLFIPHMSFIQDYCAKAIEQNIDIIKRETGITNKDIIRIPALFYVSD
FENNMTAFHYHCRKSTASDDERDTVRGSSTPPRLVKKAIIPPYPDFKIPDERAAGTPLKSHGGQWTGPTLAAWQK
KRKEEEAAERGKGKEEEDEGKEEEDKGLTYETLERLKSALPVGSFYPGSINSIVLSNSTVIAPNPWGPLVDGKDI
FAEAVTAAYAKANYTVHFVDDWFSHFIGGGDIHCATNTLRDIKVSWL
Coding >Ophio5|831
ATGTGGAACCCTATTGCCTCTTCAGCAGTCCTCATAGGCCACGTCGCGTTAACAAGAGGTGCGCCTTTCGATGTT
ACCGGCGTATCGAGCACTATATTCAACGATTTGAACAACCCCAGGATCAGGAACTCCAGCGACACACTCTTGACC
GTTACCATTTTAGCCGACACCAACCGAGATGGTGTGGTCGATACCGAAGGGGACAGCGATTATACAAGGAGGCGT
ACCTGGACCTCCGACTCGGGCGCGTTGTTCCTCGCCAACATTGTTGACACCGGTCGTCGATGCTCACTCAAGATA
CAAAAGTCCACACCCAACGAGGAACTGGAGTACTGCCACGATGCTACGGACAATGTACTCCGAAACGCAAAGTTT
CTCGCGCCGGTCCGGACCCTACCCGTGGTCACGCCCGCCCTGAGCGACAAGGCAACCGGCTCCATCACCGTGATG
GGGAAAATGGCGGCTACGAAAACGCGAATCTTTCAAAAAAGGGGAGCCGATTGGGTTTACATCAGCTCGAGTCAC
ATCTTTTCAGCTGAGGAGCTACGAGCTGGCCTCGAGCTCGGTATCGATGCTCGTGACGTCCGTCGTCCAGGAGGA
TGGGATGGAAAAGCCATGGTTCAGTTTACGGTCAAGGAGACAGGAGTGGTCAAGGCCATAGACTGGGTCCAGATG
CGTGTTGCGCCTGTGCTGATTCACAATCACCTTCAAAAGGCCGAGGCGCTTTTTGTGCAATCCGCCTTCATGATG
AACACCCATAAGAACGAAACGGCAATGCGATTCAACAGCGCACAGGCCAAGTTCGTGCGAGATATTGACACCATC
GCCCGGGAAGCAGGCTTGCCCCTATTCCAGTTCAACGACATTACCAACCACGACATATGGGTACAAGACTTCTTC
GAGCCGGGCTACATGACTATACCCGGCCCGGACGGTCCTGTCGGCCTCCGCATCATGATTCGTTCCGCCCAAAGG
GATCGTCTGGGCGGCCGCCAGGTGTTCCAGACGCTTCGGTCTGATACCATTGGTGCCGTACAGCACCTTGTTTGG
GGCGACACAAGCGACTCCATGGGAAACCTCGAGACCATCCCCCCTTACGTTCACAACGGGAAGAGATATCCCGCA
GGACGAGCCGTCATGGGGTCACAGGCAGGCATCAGACCCTTCATAATGGAATTTCTTCGGGCCCAGGAAGAGCAG
GACCCTATCGAGCTTGACACCACTTGGCTTTTCATTGGCCACGCGGACGAGTTCATGCAGTTTCTACCTCATGAC
AGTGAGCGAGGCTGGGTCTTGGTGGTCAGCGATCCTCAAGCAGGCATTAAGCTGCTACAGGATGCCACATTAGTC
GGGCATGGGGGTTCCAACTCTCACTCACGCCCGATTTATCCTACCGACAAGGAGAGTTGCTTCCCGGCCAGCACT
ATCGAGGACTCGCTCTTCATTCCCCACATGTCCTTTATACAAGACTATTGCGCCAAGGCTATAGAACAGAATATC
GACATCATCAAAAGGGAGACGGGCATCACAAACAAGGACATCATCCGCATACCAGCCCTTTTCTATGTCAGTGAC
TTTGAAAACAACATGACTGCGTTTCATTACCATTGTCGTAAGTCGACTGCGTCAGATGACGAGCGGGACACAGTC
CGGGGCAGTAGCACGCCACCACGGTTGGTCAAGAAAGCGATTATCCCTCCTTACCCAGATTTCAAAATTCCGGAT
GAGCGGGCAGCTGGCACACCATTAAAAAGCCACGGTGGCCAGTGGACAGGTCCCACTCTCGCTGCCTGGCAGAAG
AAGCGGAAAGAGGAAGAGGCAGCAGAAAGGGGCAAGGGCAAAGAAGAGGAAGACGAAGGGAAAGAGGAGGAAGAC
AAGGGCCTGACATATGAGACGTTGGAAAGGCTCAAGTCAGCCCTGCCGGTAGGCAGCTTCTACCCCGGCTCCATC
AATAGCATCGTCCTCAGCAATTCGACCGTCATTGCCCCAAACCCTTGGGGGCCGCTTGTTGATGGCAAAGACATC
TTTGCCGAGGCCGTCACCGCGGCCTACGCCAAGGCCAACTACACTGTCCACTTTGTTGATGACTGGTTCTCTCAT
TTCATCGGCGGCGGTGACATACACTGCGCGACGAATACTTTGCGCGATATAAAGGTCAGTTGGCTT
Transcript >Ophio5|831
ATGTGGAACCCTATTGCCTCTTCAGCAGTCCTCATAGGCCACGTCGCGTTAACAAGAGGTGCGCCTTTCGATGTT
ACCGGCGTATCGAGCACTATATTCAACGATTTGAACAACCCCAGGATCAGGAACTCCAGCGACACACTCTTGACC
GTTACCATTTTAGCCGACACCAACCGAGATGGTGTGGTCGATACCGAAGGGGACAGCGATTATACAAGGAGGCGT
ACCTGGACCTCCGACTCGGGCGCGTTGTTCCTCGCCAACATTGTTGACACCGGTCGTCGATGCTCACTCAAGATA
CAAAAGTCCACACCCAACGAGGAACTGGAGTACTGCCACGATGCTACGGACAATGTACTCCGAAACGCAAAGTTT
CTCGCGCCGGTCCGGACCCTACCCGTGGTCACGCCCGCCCTGAGCGACAAGGCAACCGGCTCCATCACCGTGATG
GGGAAAATGGCGGCTACGAAAACGCGAATCTTTCAAAAAAGGGGAGCCGATTGGGTTTACATCAGCTCGAGTCAC
ATCTTTTCAGCTGAGGAGCTACGAGCTGGCCTCGAGCTCGGTATCGATGCTCGTGACGTCCGTCGTCCAGGAGGA
TGGGATGGAAAAGCCATGGTTCAGTTTACGGTCAAGGAGACAGGAGTGGTCAAGGCCATAGACTGGGTCCAGATG
CGTGTTGCGCCTGTGCTGATTCACAATCACCTTCAAAAGGCCGAGGCGCTTTTTGTGCAATCCGCCTTCATGATG
AACACCCATAAGAACGAAACGGCAATGCGATTCAACAGCGCACAGGCCAAGTTCGTGCGAGATATTGACACCATC
GCCCGGGAAGCAGGCTTGCCCCTATTCCAGTTCAACGACATTACCAACCACGACATATGGGTACAAGACTTCTTC
GAGCCGGGCTACATGACTATACCCGGCCCGGACGGTCCTGTCGGCCTCCGCATCATGATTCGTTCCGCCCAAAGG
GATCGTCTGGGCGGCCGCCAGGTGTTCCAGACGCTTCGGTCTGATACCATTGGTGCCGTACAGCACCTTGTTTGG
GGCGACACAAGCGACTCCATGGGAAACCTCGAGACCATCCCCCCTTACGTTCACAACGGGAAGAGATATCCCGCA
GGACGAGCCGTCATGGGGTCACAGGCAGGCATCAGACCCTTCATAATGGAATTTCTTCGGGCCCAGGAAGAGCAG
GACCCTATCGAGCTTGACACCACTTGGCTTTTCATTGGCCACGCGGACGAGTTCATGCAGTTTCTACCTCATGAC
AGTGAGCGAGGCTGGGTCTTGGTGGTCAGCGATCCTCAAGCAGGCATTAAGCTGCTACAGGATGCCACATTAGTC
GGGCATGGGGGTTCCAACTCTCACTCACGCCCGATTTATCCTACCGACAAGGAGAGTTGCTTCCCGGCCAGCACT
ATCGAGGACTCGCTCTTCATTCCCCACATGTCCTTTATACAAGACTATTGCGCCAAGGCTATAGAACAGAATATC
GACATCATCAAAAGGGAGACGGGCATCACAAACAAGGACATCATCCGCATACCAGCCCTTTTCTATGTCAGTGAC
TTTGAAAACAACATGACTGCGTTTCATTACCATTGTCGTAAGTCGACTGCGTCAGATGACGAGCGGGACACAGTC
CGGGGCAGTAGCACGCCACCACGGTTGGTCAAGAAAGCGATTATCCCTCCTTACCCAGATTTCAAAATTCCGGAT
GAGCGGGCAGCTGGCACACCATTAAAAAGCCACGGTGGCCAGTGGACAGGTCCCACTCTCGCTGCCTGGCAGAAG
AAGCGGAAAGAGGAAGAGGCAGCAGAAAGGGGCAAGGGCAAAGAAGAGGAAGACGAAGGGAAAGAGGAGGAAGAC
AAGGGCCTGACATATGAGACGTTGGAAAGGCTCAAGTCAGCCCTGCCGGTAGGCAGCTTCTACCCCGGCTCCATC
AATAGCATCGTCCTCAGCAATTCGACCGTCATTGCCCCAAACCCTTGGGGGCCGCTTGTTGATGGCAAAGACATC
TTTGCCGAGGCCGTCACCGCGGCCTACGCCAAGGCCAACTACACTGTCCACTTTGTTGATGACTGGTTCTCTCAT
TTCATCGGCGGCGGTGACATACACTGCGCGACGAATACTTTGCGCGATATAAAGGTCAGTTGGCTTTGA
Gene >Ophio5|831
ATGTGGAACCCTATTGCCTCTTCAGCAGTCCTCATAGGCCACGTCGCGTTAACAAGAGGTGCGCCTTTCGATGTT
ACCGGCGTATCGAGCACTATATTCAACGATTTGAACAACCCCAGGATCAGGAACTCCAGCGACACACTCTTGACC
GTTACCATTTTAGCCGACACCAACCGAGATGGTGTGGTCGATACCGAAGGGGACAGCGATTATACAAGGAGGCGT
ACCTGGACCTCCGACTCGGGCGCGTTGTTCCTCGCCAACATTGTTGACACCGGTCGTCGATGCTCACTCAAGATA
CAAAAGTCCACACCCAACGAGGAACTGGAGTACTGCCACGATGCTACGGACAATGTACTCCGAAACGCAAAGTTT
CTCGCGCCGGTCCGGACCCTACCCGTGGTCACGCCCGCCCTGAGCGACAAGGCAACCGGCTCCATCACCGTGATG
GGGAAAATGGCGGCTACGAAAACGCGAATCTTTCAAAAAAGGGGAGCCGATTGGGTTTACATCAGCTCGAGTCAC
ATCTTTTCAGCTGAGGAGCTACGAGCTGGCCTCGAGCTCGGTATCGATGCTCGTGACGTCCGTCGTCCAGGAGGA
TGGGATGGAAAAGCCATGGTTCAGTTTACGGTCAAGGAGACAGGAGTGGTCAAGGCCATAGACTGGGTCCAGATG
CGTGTTGCGCCTGTGCTGATTCACAATCACCTTCAAAAGGCCGAGGCGCTTTTTGTGCAATCCGCCTTCATGATG
AACACCCATAAGAACGAAACGGCAATGCGATTCAACAGCGCACAGGCCAAGTTCGTGCGAGATATTGACACCATC
GCCCGGGAAGCAGGCTTGCCCCTATTCCAGTTCAACGACATTACCAACCACGACATATGGGTACAAGACTTCTTC
GAGCCGGGCTACATGACTATACCCGGCCCGGACGGTCCTGTCGGCCTCCGCATCATGATTCGTTCCGCCCAAAGG
GATCGTCTGGGCGGCCGCCAGGTGTTCCAGACGCTTCGGTCTGATACCATTGGTGCCGTACAGCACCTTGTTTGG
GGCGACACAAGCGACTCCATGGGAAACCTCGAGACCATCCCCCCTTACGTTCACAACGGGAAGAGATATCCCGCA
GGACGAGCCGTCATGGGGTCACAGGCAGGCATCAGACCCTTCATAATGGAATTTCTTCGGGCCCAGGAAGAGCAG
GACCCTATCGAGCTTGACACCACTTGGCTTTTCATTGGCCACGCGGACGAGTTCATGCAGTTTCTACCTCATGAC
AGTGAGCGAGGCTGGGTCTTGGTGGTCAGCGATCCTCAAGCAGGCATTAAGCTGCTACAGGATGCCACATTAGTC
GGGCATGGGGGTTCCAACTCTCACTCACGCCCGATTTATCCTACCGACAAGGAGAGTTGCTTCCCGGCCAGCACT
ATCGAGGACTCGCTCTTCATTCCCCACATGTCCTTTATACAAGACTATTGCGCCAAGGCTATAGAACAGAATATC
GACATCATCAAAAGGGAGACGGGCATCACAAACAAGGACATCATCCGCATACCAGCCCTTTTCTATGTCAGTGAC
TTTGAAAACAACATGACTGCGTTTCATTACCATTGTCGTAAGTCGACTGCGTCAGATGACGAGCGGGACACAGTC
CGGGGCAGTAGCACGCCACCACGGTTGGTCAAGAAAGCGATTATCCCTCCTTACCCAGATTTCAAAATTCCGGAT
GAGCGGGCAGCTGGCACACCATTAAAAAGCCACGGTGGCCAGTGGACAGGTCCCACTCTCGCTGCCTGGCAGAAG
AAGCGGAAAGAGGAAGAGGCAGCAGAAAGGGGCAAGGGCAAAGAAGAGGAAGACGAAGGGAAAGAGGAGGAAGAC
AAGGGCCTGACATATGAGACGTTGGAAAGGCTCAAGTCAGCCCTGCCGGTAGGCAGCTTCTACCCCGGCTCCATC
AATAGCATCGTCCTCAGCAATTCGACCGTCATTGCCCCAAACCCTTGGGGGCCGCTTGTTGATGGCAAAGACATC
TTTGCCGAGGCCGTCACCGCGGCCTACGCCAAGGCCAACTACACTGTCCACTTTGTTGATGACTGGTTCTCTCAT
TTCATCGGCGGCGGTGACATACACTGCGCGACGAATACTTTGCGCGATATAAAGGTCAGTTGGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail