Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|829
Gene name
Locationscaffold_124:9204..10331
Strand+
Gene length (bp)1127
Transcript length (bp)975
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 4.2E-19 27 173
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.1E-08 32 168
PF08659 KR KR domain 3.1E-06 28 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 25 284 2.0E-21
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 25 286 2.0E-21
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 25 316 4.0E-21
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 21 284 5.0E-21
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 4 284 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 25 284 2.0E-21
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 25 286 2.0E-21
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 25 316 4.0E-21
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 21 284 5.0E-21
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 4 284 5.0E-21
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 25 316 7.0E-21
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 21 319 7.0E-21
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 21 319 3.0E-20
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 20 284 5.0E-20
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 25 319 6.0E-20
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 25 323 8.0E-20
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 25 284 1.0E-19
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 22 281 2.0E-19
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 25 308 2.0E-19
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 25 319 3.0E-19
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 22 306 5.0E-19
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 25 319 8.0E-19
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 21 253 2.0E-18
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 21 253 3.0E-16
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 22 306 1.0E-15
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 21 284 3.0E-13
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 14 154 4.0E-12
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 25 272 2.0E-10
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 22 254 3.0E-10
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 17 150 4.0E-10
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 17 270 8.0E-10
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 19 138 3.0E-09
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 29 149 6.0E-09
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 28 151 9.0E-09
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 15 148 1.0E-08
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 26 291 1.0E-08
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 9 324 2.0E-08
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 26 252 2.0E-08
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 28 138 6.0E-08
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 28 138 6.0E-08
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 14 115 9.0E-08
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 22 283 2.0E-07
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 28 138 3.0E-07
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 26 239 5.0E-07
sp|P37058|DHB3_HUMAN Testosterone 17-beta-dehydrogenase 3 OS=Homo sapiens GN=HSD17B3 PE=1 SV=2 4 176 6.0E-07
sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 26 289 1.0E-06
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 20 242 1.0E-06
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 27 289 1.0E-06
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 26 240 1.0E-06
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 26 289 1.0E-06
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 27 289 1.0E-06
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 26 160 3.0E-06
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 24 234 3.0E-06
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 20 144 3.0E-06
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 19 141 4.0E-06
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 27 166 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 92.61 50.87 134.35
CcL In ants, during behavior modification 61.90 32.41 91.38
CcD In ants, recently dead 74.93 40.52 109.35

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.079207 no
SC16a CcD 0.382798 no
CcL CcD 0.449875 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|829
MFAFFASALLGQFKALPYPDQDCTGRVVIVSGANTGLGLEAARHFTRLNAAKVILACRNLDKAEAAKRDIEQTTG
RSGVVEAWQLDLAVLDSVKAFADRAAALERLDILVNNASVLSFEWALADGHETMVTVNVISTFLLTLRLLPTLRR
TAQRFNVAPHVVIVSSDAAFMTSFPERHADNILQRLQLNQGFNDRYNVTKLLQVMGMRQLAGACDASAKGHVIIN
TLNPGFCGTELFRSLPLPFSLVIRLGFALFARSPETGSRTIMAAAFAGDEMHGRHMTDCVLHQWPPLIAGDEGER
LCDKFWRELIQVLDGIDPGVSDNI
Coding >Ophio5|829
ATGTTCGCCTTCTTCGCTTCTGCCCTGCTGGGCCAATTCAAGGCTCTCCCGTATCCCGACCAAGACTGCACAGGA
CGCGTCGTCATCGTCAGCGGCGCCAATACCGGCCTCGGTCTAGAAGCAGCTCGCCACTTCACCCGGCTCAATGCT
GCCAAGGTGATTCTGGCCTGTCGTAACCTCGACAAGGCCGAGGCCGCCAAACGCGACATCGAGCAGACGACGGGA
CGGTCTGGCGTCGTCGAGGCGTGGCAGCTGGATCTCGCCGTTTTGGATAGCGTCAAGGCCTTTGCCGACCGCGCC
GCTGCTCTCGAGCGTCTAGATATCCTCGTTAACAATGCCAGCGTCTTGAGCTTCGAATGGGCCTTGGCTGACGGA
CACGAGACCATGGTTACCGTCAACGTCATCTCGACCTTTCTACTGACGCTGCGGCTCTTGCCCACGTTGCGCCGC
ACGGCTCAGCGTTTCAATGTGGCGCCTCATGTCGTCATCGTCTCGTCCGACGCCGCCTTTATGACGTCCTTTCCC
GAGCGTCACGCCGACAACATCCTCCAGCGCCTCCAGCTCAACCAAGGATTTAACGACCGATACAACGTCACCAAG
CTGCTGCAGGTCATGGGAATGCGCCAACTGGCCGGCGCCTGCGACGCCTCGGCCAAGGGTCATGTTATCATCAAC
ACGCTTAATCCCGGTTTCTGCGGCACTGAGCTGTTCCGCAGCTTGCCCCTTCCCTTTAGTCTCGTTATACGCCTC
GGCTTTGCCCTCTTCGCCCGTAGCCCAGAGACTGGGTCGCGTACAATCATGGCTGCTGCCTTTGCTGGCGATGAG
ATGCACGGCCGTCATATGACTGACTGCGTGCTGCACCAGTGGCCGCCGCTCATTGCTGGCGACGAGGGCGAGCGG
CTTTGCGACAAGTTTTGGCGGGAGCTGATTCAGGTTCTCGACGGTATTGACCCGGGCGTCTCGGACAACATT
Transcript >Ophio5|829
ATGTTCGCCTTCTTCGCTTCTGCCCTGCTGGGCCAATTCAAGGCTCTCCCGTATCCCGACCAAGACTGCACAGGA
CGCGTCGTCATCGTCAGCGGCGCCAATACCGGCCTCGGTCTAGAAGCAGCTCGCCACTTCACCCGGCTCAATGCT
GCCAAGGTGATTCTGGCCTGTCGTAACCTCGACAAGGCCGAGGCCGCCAAACGCGACATCGAGCAGACGACGGGA
CGGTCTGGCGTCGTCGAGGCGTGGCAGCTGGATCTCGCCGTTTTGGATAGCGTCAAGGCCTTTGCCGACCGCGCC
GCTGCTCTCGAGCGTCTAGATATCCTCGTTAACAATGCCAGCGTCTTGAGCTTCGAATGGGCCTTGGCTGACGGA
CACGAGACCATGGTTACCGTCAACGTCATCTCGACCTTTCTACTGACGCTGCGGCTCTTGCCCACGTTGCGCCGC
ACGGCTCAGCGTTTCAATGTGGCGCCTCATGTCGTCATCGTCTCGTCCGACGCCGCCTTTATGACGTCCTTTCCC
GAGCGTCACGCCGACAACATCCTCCAGCGCCTCCAGCTCAACCAAGGATTTAACGACCGATACAACGTCACCAAG
CTGCTGCAGGTCATGGGAATGCGCCAACTGGCCGGCGCCTGCGACGCCTCGGCCAAGGGTCATGTTATCATCAAC
ACGCTTAATCCCGGTTTCTGCGGCACTGAGCTGTTCCGCAGCTTGCCCCTTCCCTTTAGTCTCGTTATACGCCTC
GGCTTTGCCCTCTTCGCCCGTAGCCCAGAGACTGGGTCGCGTACAATCATGGCTGCTGCCTTTGCTGGCGATGAG
ATGCACGGCCGTCATATGACTGACTGCGTGCTGCACCAGTGGCCGCCGCTCATTGCTGGCGACGAGGGCGAGCGG
CTTTGCGACAAGTTTTGGCGGGAGCTGATTCAGGTTCTCGACGGTATTGACCCGGGCGTCTCGGACAACATTTAA
Gene >Ophio5|829
ATGTTCGCCTTCTTCGCTTCTGCCCTGCTGGGCCAATTCAAGGCTCTCCCGTATCCCGACCAAGACTGCACAGGA
CGCGTCGTCATCGTCAGCGGCGCCAATACCGGTGAAAAAACAGCCTCGATGCTGTGGTCATTCGTTCTGACTCTT
TCTCCCCTGCAGGCCTCGGTCTAGAAGCAGCTCGCCACTTCACCCGGCTCAATGCTGCCAAGGTGATTCTGGCCT
GTCGTAACCTCGACAAGGCCGAGGCCGCCAAACGCGACATCGAGCAGACGACGGGACGGTCTGGCGTCGTCGAGG
CGTGGCAGCTGGATCTCGCCGTTTTGGATAGCGTCAAGGCCTTTGCCGACCGCGCCGCTGCTCTCGAGCGTCTAG
ATATCCTCGTTAACAATGCCAGCGTCTTGAGCTTCGAATGGGCCTTGGCTGACGGACACGAGACCATGGTTACCG
TCAACGTCATCTCGACCTTTCTACTGACGCTGCGGCTCTTGCCCACGTTGCGCCGCACGGCTCAGCGTTTCAATG
TGGCGCCTCATGTCGTCATCGTCTCGTCCGACGCCGCCTTTATGGTGCGTCCCTTCTACCCGTAGGCACTGAACA
AGGTGCCCTACGAGTGGAGCTCCCAGAGGCAAATCGAATCGACACTAACACGGACGAGTCGGCAGACGTCCTTTC
CCGAGCGTCACGCCGACAACATCCTCCAGCGCCTCCAGCTCAACCAAGGATTTAACGACCGATACAACGTCACCA
AGCTGCTGCAGGTCATGGGAATGCGCCAACTGGCCGGCGCCTGCGACGCCTCGGCCAAGGGTCATGTTATCATCA
ACACGCTTAATCCCGGTTTCTGCGGCACTGAGCTGTTCCGCAGCTTGCCCCTTCCCTTTAGTCTCGTTATACGCC
TCGGCTTTGCCCTCTTCGCCCGTAGCCCAGAGACTGGGTCGCGTACAATCATGGCTGCTGCCTTTGCTGGCGATG
AGATGCACGGCCGTCATATGACTGACTGCGTGCTGCACCAGTGGCCGCCGCTCATTGCTGGCGACGAGGGCGAGC
GGCTTTGCGACAAGTTTTGGCGGGAGCTGATTCAGGTTCTCGACGGTATTGACCCGGGCGTCTCGGACAACATTT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail