Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|829
Gene name
Locationscaffold_124:9204..10331
Strand+
Gene length (bp)1127
Transcript length (bp)975
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 4.2E-19 27 173
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.1E-08 32 168
PF08659 KR KR domain 3.1E-06 28 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 25 284 2.0E-21
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 25 286 2.0E-21
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 25 316 4.0E-21
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 21 284 5.0E-21
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 4 284 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 25 284 2.0E-21
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 25 286 2.0E-21
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 25 316 4.0E-21
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 21 284 5.0E-21
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 4 284 5.0E-21
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 25 316 7.0E-21
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 21 319 7.0E-21
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 21 319 3.0E-20
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 20 284 5.0E-20
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 25 319 6.0E-20
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 25 323 8.0E-20
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 25 284 1.0E-19
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 22 281 2.0E-19
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 25 308 2.0E-19
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 25 319 3.0E-19
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 22 306 5.0E-19
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 25 319 8.0E-19
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 21 253 2.0E-18
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 21 253 3.0E-16
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 22 306 1.0E-15
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 21 284 3.0E-13
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 14 154 4.0E-12
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 25 272 2.0E-10
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 22 254 3.0E-10
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 17 150 4.0E-10
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 17 270 8.0E-10
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 19 138 3.0E-09
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 29 149 6.0E-09
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 28 151 9.0E-09
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 15 148 1.0E-08
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 26 291 1.0E-08
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 9 324 2.0E-08
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 26 252 2.0E-08
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 28 138 6.0E-08
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 28 138 6.0E-08
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 14 115 9.0E-08
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 22 283 2.0E-07
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 28 138 3.0E-07
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 26 239 5.0E-07
sp|P37058|DHB3_HUMAN Testosterone 17-beta-dehydrogenase 3 OS=Homo sapiens GN=HSD17B3 PE=1 SV=2 4 176 6.0E-07
sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 26 289 1.0E-06
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 20 242 1.0E-06
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 27 289 1.0E-06
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 26 240 1.0E-06
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 26 289 1.0E-06
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 27 289 1.0E-06
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 26 160 3.0E-06
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 24 234 3.0E-06
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 20 144 3.0E-06
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 19 141 4.0E-06
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 27 166 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|829
MFAFFASALLGQFKALPYPDQDCTGRVVIVSGANTGLGLEAARHFTRLNAAKVILACRNLDKAEAAKRDIEQTTG
RSGVVEAWQLDLAVLDSVKAFADRAAALERLDILVNNASVLSFEWALADGHETMVTVNVISTFLLTLRLLPTLRR
TAQRFNVAPHVVIVSSDAAFMTSFPERHADNILQRLQLNQGFNDRYNVTKLLQVMGMRQLAGACDASAKGHVIIN
TLNPGFCGTELFRSLPLPFSLVIRLGFALFARSPETGSRTIMAAAFAGDEMHGRHMTDCVLHQWPPLIAGDEGER
LCDKFWRELIQVLDGIDPGVSDNI
Coding >Ophio5|829
ATGTTCGCCTTCTTCGCTTCTGCCCTGCTGGGCCAATTCAAGGCTCTCCCGTATCCCGACCAAGACTGCACAGGA
CGCGTCGTCATCGTCAGCGGCGCCAATACCGGCCTCGGTCTAGAAGCAGCTCGCCACTTCACCCGGCTCAATGCT
GCCAAGGTGATTCTGGCCTGTCGTAACCTCGACAAGGCCGAGGCCGCCAAACGCGACATCGAGCAGACGACGGGA
CGGTCTGGCGTCGTCGAGGCGTGGCAGCTGGATCTCGCCGTTTTGGATAGCGTCAAGGCCTTTGCCGACCGCGCC
GCTGCTCTCGAGCGTCTAGATATCCTCGTTAACAATGCCAGCGTCTTGAGCTTCGAATGGGCCTTGGCTGACGGA
CACGAGACCATGGTTACCGTCAACGTCATCTCGACCTTTCTACTGACGCTGCGGCTCTTGCCCACGTTGCGCCGC
ACGGCTCAGCGTTTCAATGTGGCGCCTCATGTCGTCATCGTCTCGTCCGACGCCGCCTTTATGACGTCCTTTCCC
GAGCGTCACGCCGACAACATCCTCCAGCGCCTCCAGCTCAACCAAGGATTTAACGACCGATACAACGTCACCAAG
CTGCTGCAGGTCATGGGAATGCGCCAACTGGCCGGCGCCTGCGACGCCTCGGCCAAGGGTCATGTTATCATCAAC
ACGCTTAATCCCGGTTTCTGCGGCACTGAGCTGTTCCGCAGCTTGCCCCTTCCCTTTAGTCTCGTTATACGCCTC
GGCTTTGCCCTCTTCGCCCGTAGCCCAGAGACTGGGTCGCGTACAATCATGGCTGCTGCCTTTGCTGGCGATGAG
ATGCACGGCCGTCATATGACTGACTGCGTGCTGCACCAGTGGCCGCCGCTCATTGCTGGCGACGAGGGCGAGCGG
CTTTGCGACAAGTTTTGGCGGGAGCTGATTCAGGTTCTCGACGGTATTGACCCGGGCGTCTCGGACAACATT
Transcript >Ophio5|829
ATGTTCGCCTTCTTCGCTTCTGCCCTGCTGGGCCAATTCAAGGCTCTCCCGTATCCCGACCAAGACTGCACAGGA
CGCGTCGTCATCGTCAGCGGCGCCAATACCGGCCTCGGTCTAGAAGCAGCTCGCCACTTCACCCGGCTCAATGCT
GCCAAGGTGATTCTGGCCTGTCGTAACCTCGACAAGGCCGAGGCCGCCAAACGCGACATCGAGCAGACGACGGGA
CGGTCTGGCGTCGTCGAGGCGTGGCAGCTGGATCTCGCCGTTTTGGATAGCGTCAAGGCCTTTGCCGACCGCGCC
GCTGCTCTCGAGCGTCTAGATATCCTCGTTAACAATGCCAGCGTCTTGAGCTTCGAATGGGCCTTGGCTGACGGA
CACGAGACCATGGTTACCGTCAACGTCATCTCGACCTTTCTACTGACGCTGCGGCTCTTGCCCACGTTGCGCCGC
ACGGCTCAGCGTTTCAATGTGGCGCCTCATGTCGTCATCGTCTCGTCCGACGCCGCCTTTATGACGTCCTTTCCC
GAGCGTCACGCCGACAACATCCTCCAGCGCCTCCAGCTCAACCAAGGATTTAACGACCGATACAACGTCACCAAG
CTGCTGCAGGTCATGGGAATGCGCCAACTGGCCGGCGCCTGCGACGCCTCGGCCAAGGGTCATGTTATCATCAAC
ACGCTTAATCCCGGTTTCTGCGGCACTGAGCTGTTCCGCAGCTTGCCCCTTCCCTTTAGTCTCGTTATACGCCTC
GGCTTTGCCCTCTTCGCCCGTAGCCCAGAGACTGGGTCGCGTACAATCATGGCTGCTGCCTTTGCTGGCGATGAG
ATGCACGGCCGTCATATGACTGACTGCGTGCTGCACCAGTGGCCGCCGCTCATTGCTGGCGACGAGGGCGAGCGG
CTTTGCGACAAGTTTTGGCGGGAGCTGATTCAGGTTCTCGACGGTATTGACCCGGGCGTCTCGGACAACATTTAA
Gene >Ophio5|829
ATGTTCGCCTTCTTCGCTTCTGCCCTGCTGGGCCAATTCAAGGCTCTCCCGTATCCCGACCAAGACTGCACAGGA
CGCGTCGTCATCGTCAGCGGCGCCAATACCGGTGAAAAAACAGCCTCGATGCTGTGGTCATTCGTTCTGACTCTT
TCTCCCCTGCAGGCCTCGGTCTAGAAGCAGCTCGCCACTTCACCCGGCTCAATGCTGCCAAGGTGATTCTGGCCT
GTCGTAACCTCGACAAGGCCGAGGCCGCCAAACGCGACATCGAGCAGACGACGGGACGGTCTGGCGTCGTCGAGG
CGTGGCAGCTGGATCTCGCCGTTTTGGATAGCGTCAAGGCCTTTGCCGACCGCGCCGCTGCTCTCGAGCGTCTAG
ATATCCTCGTTAACAATGCCAGCGTCTTGAGCTTCGAATGGGCCTTGGCTGACGGACACGAGACCATGGTTACCG
TCAACGTCATCTCGACCTTTCTACTGACGCTGCGGCTCTTGCCCACGTTGCGCCGCACGGCTCAGCGTTTCAATG
TGGCGCCTCATGTCGTCATCGTCTCGTCCGACGCCGCCTTTATGGTGCGTCCCTTCTACCCGTAGGCACTGAACA
AGGTGCCCTACGAGTGGAGCTCCCAGAGGCAAATCGAATCGACACTAACACGGACGAGTCGGCAGACGTCCTTTC
CCGAGCGTCACGCCGACAACATCCTCCAGCGCCTCCAGCTCAACCAAGGATTTAACGACCGATACAACGTCACCA
AGCTGCTGCAGGTCATGGGAATGCGCCAACTGGCCGGCGCCTGCGACGCCTCGGCCAAGGGTCATGTTATCATCA
ACACGCTTAATCCCGGTTTCTGCGGCACTGAGCTGTTCCGCAGCTTGCCCCTTCCCTTTAGTCTCGTTATACGCC
TCGGCTTTGCCCTCTTCGCCCGTAGCCCAGAGACTGGGTCGCGTACAATCATGGCTGCTGCCTTTGCTGGCGATG
AGATGCACGGCCGTCATATGACTGACTGCGTGCTGCACCAGTGGCCGCCGCTCATTGCTGGCGACGAGGGCGAGC
GGCTTTGCGACAAGTTTTGGCGGGAGCTGATTCAGGTTCTCGACGGTATTGACCCGGGCGTCTCGGACAACATTT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail